KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0308Help
Entry
y0308             CDS       T00092                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    y0308 (ppc)
  Energy metabolism
   00680 Methane metabolism
    y0308 (ppc)
Enzymes [BR:ypk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     y0308 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(328859..331555)
Genome map
AA seq 898 aa AA seqDB search
MNIASNPAASNTKDKWVRGHMNEQYSAMRSNVSMLGTLLGDTIKEALGEHILDRVETIRK
LSKSSRAGNEASRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAASN
PEALAQLFTRLKDKKLSDQDMRSAVDDLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQL
DHNDLADYERNKIMRRLRQLVAQSWHTDEIRKLRPSPVDEAKWGFAVVENSLWEGVPAFL
REFNEQLENSLDYRLPVEAVPIRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLR
DIQVLVSELSMSECTPELRELAGGEEVLEPYRQLMKNVRTQLTNTQAYLEARLKGERVLP
PHDLLVSNDQLWEPLYACYQSLKACGMEIIANGQLLDTLRRVRCFGVPLVRIDVRQESTR
HTDAIAELTRYLGLGDYESWSESDKQAFLVRELNSKRPLVPLKWEPSAETQEVLETCRVI
AEAPQGSIAAYVISMAKVPSDVLAVHLLLKEAGCPFTLPVAPLFETLDDLNNADDVMTQL
LGIDWYRGLIQGKQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTCEKAGITLTLFHGR
GGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAILEA
NLLPPPEPKKEWIEVMDLLSDASCDMYRSYVRENPEFVRYFRAATPELELGKLPLGSRPA
KRRPDGGVESLRAIPWIFAWTQNRLMLPAWLGAGAGLQRAIDAGKQDVLATMCRDWPFFS
TRIGMLEMVFAKADLWLAEYYDQRLVDKSLWPLGQQLRDQLAADIKVVLAIANDDHLMAD
LPWIAESIALRNVYTDPLNVLQAELLHRSRQQEHPDACVEQALMVTIAGVAAGMRNTG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
gtgaacatagctagcaatcctgcggcttcaaacacgaaggataaatgggtcagaggtcat
atgaacgaacaatattccgcaatgcgaagtaacgtcagtatgctcggcacactactcgga
gacaccatcaaggaagcgttgggagagcatattcttgatagagtagaaaccatccggaaa
ttatccaaatcttcgcgtgcgggtaatgaagcgagccgtcaggaattactgaccacactg
caaaatctttccaacgatgagctactgccggtcgcccgtgcctttagccaattccttaat
ctgacgaatacggcagagcaataccacagtatttcaccacatggtgaagccgcgagtaat
ccggaagccctcgcccaattatttacccgcttaaaagataaaaagctgagcgatcaagat
atgcgcagcgcggttgacgatttgtcgattgagttggtcttgactgcccacccaaccgaa
attacccgccgcaccttgatccataaactggttgaagtgaatacctgcctgagccagttg
gatcacaatgatttagccgattacgaacgcaacaagatcatgcgtcgtttacggcagtta
gttgcacaatcgtggcataccgacgaaattcgcaaactgcgtccctcgcccgttgatgaa
gccaaatggggctttgcggtggtggaaaacagcctgtgggaaggcgtccctgcattcctg
cgtgagtttaacgagcagttagagaactcccttgattaccgtctacccgtggaagcggta
cctattcgctttacttcatggatgggcggtgaccgcgatggtaacccgaatgtaacggct
gaaatcactcgccatgtgctgctactcagccgttggaaagccaccgatttattcctgcgt
gatattcaggtgctggtgtctgaactttctatgtcggaatgtaccccggagctgcgtgaa
ttagccggtggtgaagaggtgcttgaaccttatcgccaactgatgaagaacgttcgtacc
caattgaccaatacccaggcttatctggaagcgcgtctgaaaggcgagcgcgtattgcca
ccacacgatttactggtcagtaatgatcaactgtgggaaccgctctacgcctgctatcaa
tcgctgaaagcctgtggcatggaaatcatcgccaacggtcagttgttggataccctacgc
cgtgtgcgttgttttggtgtgccattggtgcgcattgatgtgcgtcaggaaagtacccgt
cataccgatgctatcgcggagctgacccgttatctgggccttggtgattatgagagttgg
tctgaatcagacaagcaagcctttttggtccgcgaactgaactctaagcgcccactggtt
cctctaaaatgggaacctagcgccgagacacaagaagtgctggaaacctgtcgggtgatt
gctgaagcaccgcaaggttctatcgctgcttacgttatctctatggcgaaagtgccgtca
gacgtgctggccgtgcatttgttactgaaagaagcgggttgcccatttactctacctgtc
gccccgctattcgagaccctcgatgacttgaacaacgctgacgatgtcatgacccagttg
ctgggtatcgattggtatcgtggcctgatccaaggcaagcagatggtgatgattggctat
tctgactcggcaaaagacgccggtgttatggcggcctcttgggcacaataccgggcgcag
gatgcactgattaaaacctgtgagaaagccgggattacgctgacattgttccatggccgt
gggggttctattggtcgtggtggtgcgccagcccatgcggcattgctctctcagcctccg
ggcagtctgaaaggcggcttacgggttaccgaacaaggcgagatgattcgctttaagttt
gggttaccggaagtcaccatcagcagcctggcgctgtacgcaggtgcaattctggaagcc
aatctgttaccgccaccagagccgaagaaagagtggattgaagtgatggatctgctgtca
gacgcctcttgcgacatgtaccgcagctacgttcgtgaaaatccagagttcgtccgttac
ttccgtgctgcgacaccggaattggaacttggcaagctgcctctgggttcccgcccagcc
aaacgccgcccggacggtggagtggaaagtctgcgggcgatcccatggattttcgcctgg
acacaaaaccgtctgatgctccctgcctggttgggtgccggtgcgggtttgcagagagcg
atcgatgcaggtaagcaagatgtactcgccaccatgtgccgtgactggccgttcttctcg
acccgcattggtatgctggagatggtcttcgccaaagccgatttgtggctggcagaatat
tatgatcagcgtttagtggataaatcgctatggccgttaggtcagcagttacgtgaccaa
ctggcagccgatattaaagtggtgttggctatcgccaacgatgaccatttgatggctgac
ttgccatggattgccgaatccatcgcgttgcgtaacgtgtacaccgatccattaaacgta
ctgcaagccgagctgttgcaccgttcacgccagcaagaacaccctgatgcctgtgttgaa
caagcgttgatggtgaccattgccggtgtggctgcggggatgcggaataccggttag

DBGET integrated database retrieval system