KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0310Help
Entry
y0310             CDS       T00092                                 

Gene name
argC
Definition
(GenBank) N-acetyl-gamma-glutamylphosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00220  Arginine biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01210  2-Oxocarboxylic acid metabolism
ypk01230  Biosynthesis of amino acids
Module
ypk_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    y0310 (argC)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     y0310 (argC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC Epimerase GFO_IDH_MocA DUF4459 NAD_binding_10 DapB_N CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAM83901
UniProt: Q8ZA86
Position
333283..334287
Genome map
AA seq 334 aa AA seqDB search
MLNTLIVGASGYAGAELTAYLNRHPHMNITGLAVSAQSADAGKLLSDLHPQLKGILDLPL
QPLVDVAQAAKGIDVVFLATAHEVSHDLAPQFLAAGCVVFDLSGAFRVRDAAFYSQYYGF
EHQHPDWLDKAVYGLAEWQSEDIKQAQLIAVPGCYPTASQLALKPLVDGQLLNDAQWPVI
NAVSGVSGAGRKASMGNSFCEVSLQPYGLFTHRHQPEIVTHLGTPVIFTPHLGNFARGIL
ATITCRLKAGVTAQNIADAYHHAYQNKPLVRLYQQGVPALKAVVGLPFCDIGFSVQGEHL
IIVATEDNLLKGAAAQAVQCMNIRFGFPETQSLL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatacgttgattgttggtgccagtggctatgccggcgcggagcttacggcttac
cttaatcgtcacccacatatgaacataaccggtttagcggtttcagcgcaaagtgcagat
gcaggaaaattactttccgatctgcatccacagttaaaaggcattcttgacctcccgcta
cagcccttggtagatgtggctcaggcggctaaaggtatcgatgtggttttcctcgctacc
gctcatgaggtcagccatgatttggcaccacaatttttagccgctggctgtgtggtattt
gatctttccggtgcattccgtgtgcgtgatgcggcgttttacagccaatattacggtttt
gaacaccaacatcccgattggctcgataaggcggtttatggcctggcagaatggcaatca
gaagacattaagcaagctcaattgattgctgttcctggttgttatccaaccgcatcacaa
ctggcgcttaaaccgttggttgatgggcaattactgaacgatgcacagtggccagtcatt
aatgccgtcagtggtgtcagcggtgcagggcgtaaagccagcatgggcaacagcttctgt
gaagttagcttgcagccatatggcctatttacccaccgtcaccagccagaaattgttacc
catcttggcacccccgtcatttttacaccgcatctggggaattttgcccgagggatcttg
gcgacgattacctgccgcctgaaagctggggtcacggcgcaaaacatcgccgatgcctat
caccatgcttatcagaataagccactggtgcggttgtatcaacaaggtgtcccggcgctg
aaagccgtggtcggcctacctttctgtgatattggtttctcggtacaaggcgagcattta
attattgttgccaccgaagataacctgctgaaaggtgctgcggctcaggccgtacaatgt
atgaatatccgttttggcttcccggaaacgcagtccctgttgtag

DBGET integrated database retrieval system