KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0314Help
Entry
y0314             CDS       T00092                                 

Gene name
hasA
Definition
(GenBank) secreted hemophore
  KO
K12545  
heme acquisition protein HasA
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Pores ion channels [TC:1]
   y0314 (hasA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
340082..340699
Genome map
AA seq 205 aa AA seqDB search
MSTTIQYNSNYADYSISSYLREWANNFGDIDQAPAETKDRGSFSGSSTLFSGTQYAIGSS
HSNPEGMIAEGDLKYSFMPQHTFHGQIDTLQFGKDLATNAGGPSAGKHLEKIDITFNELD
LSGEFDSGKSMTENHQGDMHKSVRGLMKGNPDPMLEVMKAKGINVDTAFKDLSIASQYPD
SGYMSDAPMVDTVGVVDCHDMLLAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagtacaactattcaatataacagtaattatgccgattacagcatctcctcttatctt
cgggaatgggctaataactttggtgatattgatcaagctccagctgaaacaaaagatcgt
gggagtttctctggttcctcaaccttatttagcggtactcaatatgcgattggtagctcg
catagtaatccagagggaatgattgctgagggtgatttgaaatactcctttatgcctcag
catactttccatgggcaaatagacaccctgcagtttggtaaggatttagctactaatgcg
ggtggccctagtgcaggtaaacatcttgaaaaaattgatataacctttaacgaactggat
cttagcggtgaatttgattctggtaaatcaatgacagaaaaccaccaaggcgatatgcat
aaatccgtacgtggtttgatgaaaggtaacccagatccaatgctggaagtgatgaaagcc
aaaggcattaatgtcgatactgcctttaaagacctgtctattgccagccaatatcctgac
agtggttatatgtctgatgcgccaatggtggataccgttggtgtggtggattgccacgat
atgctgctagccgcttaa

DBGET integrated database retrieval system