KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0317Help
Entry
y0317             CDS       T00092                                 

Gene name
hasB
Definition
(GenBank) TonB-like protein
  KO
K03832  
periplasmic protein TonB
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   y0317 (hasB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
344142..344945
Genome map
AA seq 267 aa AA seqDB search
MNRLQQSSDKLIFWLVGALLACGIHIYALWWLSTASIPAIPTSYPAAIMMELSAEPEFMQ
NLPQNSVVGITQNIIEPAVEQRVNQPDDIVDLPTLPEQPEGQREITRKEPIKVKRPAENR
ATSRKPVNKETQESDSKQSSPAAAASAMLSGTSQQVAAAVNSDSSHRQQAQVSWKSRLQG
HLMGFKRYPSSARKQQQQGTAMIRFVVDKNGYVSSVQLSHSSGTSALDREALAIIKRAQP
LPKPPAELLSQGQITLSLPVDFNLKRK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaatagattacagcagagcagtgacaaacttatattttggctagtcggggccttatta
gcgtgtggtatccatatttatgcactttggtggctgagtaccgcatctataccagcaata
cccaccagctaccccgccgcaataatgatggagctttcagccgaaccggaatttatgcaa
aacttgccacaaaactcagtggtgggcataacgcagaatattatcgagcctgcggttgag
caacgggtcaaccagccggatgacattgtcgatttacctacgctgcctgaacaaccagag
gggcaacgggagattacgagaaaagagccaataaaggtcaaacggccagctgaaaataga
gcgacatcgcgtaaaccggttaataaagaaacacaagaaagtgacagtaaacaatcctca
ccagccgctgcagccagtgcaatgctttcagggacgagccaacaagttgccgcagcggta
aacagtgactcatcccaccgtcagcaagctcaagtgagttggaaaagtcgtttacagggg
catttaatggggtttaagcgttacccatccagtgccagaaaacagcaacagcaagggact
gccatgattcgatttgtagtcgataaaaatggttatgtgtcatcagtgcaactgagtcac
agtagtggtacatccgctttagatcgcgaggcgttagcgattatcaagcgcgctcagcca
ttaccgaaaccgcctgctgagttgttatcgcaggggcagataacattatctctgcccgtt
gattttaatctaaaaaggaaataa

DBGET integrated database retrieval system