KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0318Help
Entry
y0318             CDS       T00092                                 

Definition
(GenBank) putative pyridine nucleotide-disulphide oxidoreductase
  KO
K00382  
dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y0318
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y0318
   00020 Citrate cycle (TCA cycle)
    y0318
   00620 Pyruvate metabolism
    y0318
   00630 Glyoxylate and dicarboxylate metabolism
    y0318
   00640 Propanoate metabolism
    y0318
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y0318
   00280 Valine, leucine and isoleucine degradation
    y0318
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     y0318
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   y0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(345061..346524)
Genome map
AA seq 487 aa AA seqDB search
MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEA
VHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLESVETIPAADKIQGYARFI
DDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNELGDRLIINDDVFNWDDLPESV
AVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQAD
RLTMQTNVPHIFIAGDASNQLPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDP
QIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLKNKGILRIYGEQGTGRFLGAE
MMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
CLRCPGE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccttaaacgttgatgtcgctgttattggcggcggaacggccggactgggcgct
tatcgcgcggccaaactgttgacccccaacgtagtgatgattgaaggtggtgaatatggt
accacctgcgcacgcgtcggctgcatgccatccaaactattgattgcggcggctgaagcc
gtccaccagatagaaaaagcgcccggatttggtattcacccacaaggtaagcccctgatt
aatggccgtgaagtcatggaccgcgttaagcgtgaacgtgaccgttttgtgggcttcgta
ttggaaagcgtagagaccattcctgcggccgataaaattcaaggttatgcccgttttatt
gatgataacaccctgcaagttgatgatcacacgcagcttacttcacaaaaaatcattgcg
cagcggatcgtgattgcgacaggttcccgcccaagctggcccgcctcttggaatgagcta
ggtgaccggttgattattaatgatgacgtctttaattgggacgatctgccagaatctgtg
gcagtttttggcccaggcgttattggcttagaacttggtcaggcactgcaccggttaggt
gtccaggtaaaaatgtttggtgtcggtggtgccgttggcccgctgaccgacagtatcgtg
cgtgactacgcagcaaaaacgttgggtgatgagttctatcttgatcccgatgtaaaagtt
gagctgatgcaacgtgagggagataaagtctttatccgttatctggataaaagcggtagg
ccacaggagattatggtggactacgtcttagccgccacgggccgccgccctaatgtagat
aaattggggctggagaatacgtcactcattctggatgaacgcggagtgccgcaggcagac
cgcctgaccatgcaaaccaacgtgccgcatatttttattgcaggtgatgccagcaatcag
ttgccattactgcatgaagccagcgatcaggcacgtattgccggtgtaaatgcgggagga
ttccctgaggttgtacccggtttacgccgtagcccaatttcagtcgtgttctctgaccca
caaattgccatggtgggggcaaccttccgtgagctagcacaaaaattcagcgcttgtggt
tgctttgagattggcgaagtctcctttgagaatcaaggtcgctcgcgggtgatgctaaaa
aacaaaggcattttacgcatttatggcgaacagggcactggccgattcttaggggcagag
atgatggggccaagtgcggagcacatcgcccacttactggcatgggcgcatcagcaacaa
atgaccatcgaccagatgctcgatatgccgttttatcatccggtcattgaagaaggcctg
cgtaccgcattgcgtgatttgcaatctaagttaaagctgggcgctgatgaagcggagcgc
tgcctacgctgccctggcgaataa

DBGET integrated database retrieval system