KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0325Help
Entry
y0325             CDS       T00092                                 

Gene name
btuB
Definition
(GenBank) outer membrane receptor for transport of vitamin B12, E colicins, and bacteriophage BF23
  KO
K16092  
vitamin B12 transporter
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Pores ion channels [TC:1]
   y0325 (btuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
352703..354664
Genome map
AA seq 653 aa AA seqDB search
MAVAYYRPWHCGIRQLSLDALLMIIKNTMTIKKYTLLTALSVTAFSGWAQGNNTTDNNDE
MVVTANRFPQPKSSVLAPVDVVTRADIDRWQSTNINDVLRRLPGVDIAQDGGMGQRSSLF
IRGTNSSHVLVLIDGVRLNQAGITGASDLSQIPISLVQRIEYIRGPRSAVYGSDAIGGVI
NILTGRDKPGTTLSAGLGSNGYQTYDGSTQQKLGEDTTVTLAGNYTYSKGYDVVAGMPGA
GGPRQPDRDGFMGKMLWAGLEHQFNEQFNGFARVYGFDNRSDYDGYTNYSNPLALIDTRK
LSSRTYDTGLRYKNGIYASQFIASYNRTKDYNYSPLFGQHDITASLDEAEQYNLQWGNTF
QLTNGMISAGADWQEQRTERKSSNQNTTADFTQHNTGIYLTGQQQISDVTLEGAVRSDDN
SQFGWHSTWQTSAGWEFIDGYRLIGSYGTAYKAPNLMQLYSAYGGNANLKPEESKQWEGG
VEGLTGPLTWRLSAYRNDIDQLIDYSNLTNGYFNINKATIKGVEWTGSFDTGPLSHQVTL
EYLDPRNADTHEILVRRAKQQVKYQLDWQVADLDWSVTYQYLGQRYDKDYSTYPEETVEL
GGVSLWDLAVSYPVTSHLTVRGRIANLFDKDYEMVYGYQTPGREYYFTGSYNF
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgcgtactaccggccatggcactgcggcatccgccaattgagtttggatgct
ctcttaatgataattaaaaatacaatgacaattaaaaaatatacgctgctcacagccctt
tctgtgacggcattttctggctgggcgcagggtaataacaccacggacaacaatgatgaa
atggttgtaacagccaaccgttttccacaaccgaaaagtagtgtattagcgcctgtcgat
gtagtcactcgtgccgatattgatcgctggcaatctacaaatataaatgatgtcttacgc
cgcttaccgggtgttgatattgctcaggatggcggtatgggccagcgcagttctttattt
atccggggcactaattctagccatgtcttggttctgatcgatggcgtccgcctcaatcaa
gcggggattaccggcgcatcagatctcagtcaaatccctatttcattggtacagcgcatc
gaatacattcgtggtccacgttctgccgtctatggttcagatgccattggaggggtgatt
aatatcctgactggacgggataaaccaggaaccacactttctgctgggttgggttcaaac
ggttatcaaacctatgatggttccactcaacagaaactgggtgaagacacgacggtgaca
ttggcgggaaattacacttatagcaaagggtatgatgtggttgctggtatgccgggagca
ggtggaccacgtcagcctgaccgggatggtttcatggggaaaatgctgtgggcgggctta
gaacatcagtttaacgagcagtttaatggttttgcccgagtatatggtttcgataaccgc
agtgattatgacgggtataccaactatagcaatccattggcgttaatcgatacccgtaaa
ctctccagccgtacctatgacacgggactacgctacaagaatggcatttatgcttcccaa
tttattgccagttataaccgaactaaagattataattacagcccacttttcggccagcat
gatattacggcctcgttagatgaagctgagcaatataacttgcaatggggtaacaccttc
cagttaacgaatggcatgatcagtgcgggtgcggattggcaagagcaaagaaccgaacgt
aaaagcagtaaccagaatactacggccgattttacgcagcacaacacgggcatctatttg
acaggccaacagcaaatcagcgacgttacattagagggggctgtacgcagtgacgataac
tcgcagtttgggtggcactcaacttggcagaccagcgccggttgggaatttattgatggc
taccgcttgattggttcttacggcacagcctataaggcacctaatctgatgcagctttat
agcgcttacggtggtaatgccaatctgaaaccggaagaaagtaagcaatgggaaggtggc
gtcgaaggattaacggggccgctgacttggcgtctatctgcttatcgtaacgatattgat
cagcttatcgattacagcaatctgaccaacggttatttcaatatcaataaagccacgatt
aaaggtgttgaatggacaggttcgtttgatactgggccgttatcacatcaagtgacgctg
gaatatctggacccacgtaatgcagatacccacgaaattctggtgcgccgagccaagcaa
caagtaaaatatcagttggattggcaggtagctgatttggattggtctgttacctaccaa
tatcttggtcagcgttatgacaaagactacagcacttatccagaagaaacggttgaactc
ggtggtgtgagcctttgggatctcgctgtttcgtatccggtcacatctcatctcacggtt
cgtggtagaattgccaacctgtttgataaagattatgagatggtttatggctaccaaacc
ccaggacgcgaatactacttcacgggaagctataacttctaa

DBGET integrated database retrieval system