KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0338Help
Entry
y0338             CDS       T00092                                 

Gene name
ilvD
Definition
(GenBank) dihydroxyacid dehydratase
  KO
K01687  
dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    y0338 (ilvD)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    y0338 (ilvD)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     y0338 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
373725..375623
Genome map
AA seq 632 aa AA seqDB search
MRQTLICKIKTRSEETMPKYRSHTTTHGRNMAGARALWRATGMTDDDFGKPIIAVVNSFT
QFVPGHVHLRDLGKLVAEQIVASGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLDL
IDAMIQGANPNVSDEESAQIERSACPTCGSCSGMFTANSMNCLNEALGLALPGNGSLLAT
HADRKQLFLDAGKHIVALTKRYYEQDDVSALPRNIANKAAFENAMILDIAMGGSTNTVLH
LLAAAQEGEIDFSMTDIDHLSRKVPHLCKVAPSTQKYHMEDVHRAGGVIGILGELDRAGL
LNRDVSNVLGLNLTQTLEAYDVMLTQDEGVKQMYAAGPAGIRTTKAFSQDCRYPSLDTDR
EEGCIRTREHAYSQDGGLAVLYGNIAADGCIVKTAGVDKDSLTFRGPAKVFESQDEAVEA
ILGGKVVAGDVVVIRYEGPKGGPGMQEMLYPTTYLKSMGLGKSCALLTDGRFSGGTSGLS
IGHVSPEAASGGLIGLVQDGDFINIDIPNRGIVLDVSEAELAARRETEEAHGDAAWSPKG
RERQVSYALRAYAMLATSADKGAVRDKSKLGG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
ttgcgacagacattgatttgcaaaataaaaacgcggagtgaagagacaatgcctaagtac
cgttcccataccaccacccatggccgcaatatggccggcgcccgcgcactgtggcgcgca
accggtatgaccgatgatgacttcggcaaaccgattattgcagtcgttaactcctttacc
caatttgtaccgggccacgtacatttgcgcgatttaggcaagctggttgcggagcaaatt
gtagcttctggcggtgtggctaaagagttcaacaccattgcggtggatgatggtatcgcg
atgggccacggtggcatgctctactctctgccatcgcgtgaattgatcgccgactccgtt
gagtacatggttaacgcccactgtgcggatgccatggtgtgtatctctaactgtgacaaa
attaccccagggatgctgatggcgtctctgcgcctgaatattccggtgatctttgtgtct
ggtggcccgatggaagccggtaagaccaagctgtcagataaaatcatcaagctggatttg
atcgatgccatgattcagggtgcgaatcctaatgtgagcgatgaagagagcgcccagatt
gagcgttctgcttgcccgacctgtggttcttgctccggtatgtttacggctaactcgatg
aactgcctgaatgaagcgctgggtctggcgttgccgggtaacggttcattgttggcaacc
cacgctgaccgtaagcaactgttcttggatgcgggtaaacacattgttgccttgaccaaa
cgttattatgaacaagatgacgtcagcgccttgccacgcaacatcgcgaataaagcggcc
tttgaaaacgccatgatattggatatcgccatgggcggttccacgaataccgtattgcat
ttgctggcggcggcgcaggaaggtgaaattgatttcagcatgaccgatatcgatcacctg
tcccgtaaagtcccacatttgtgcaaagtggccccgagtactcagaaataccacatggaa
gatgtgcaccgtgcggggggggtcattggtattttaggtgagttggatcgcgctggtttg
cttaaccgcgatgtcagtaacgtgttggggctgaatctgacacaaacgctggaagcctat
gacgtgatgctgactcaggatgaaggcgtgaagcagatgtacgccgcaggcccagccggt
attcgcaccactaaagcgttctcacaggattgccgttatccgtcactggataccgatcgc
gaagagggttgtatccgtacccgtgaacatgcctacagccaggatggtggtttagcggtg
ttgtacggcaatattgcggcagacggctgtattgttaaaactgcgggtgttgataaagac
agcctgacgttccgtggcccggcgaaagtatttgagagccaggatgaggcggtagaggcg
atcctcggtggtaaagttgtggcgggtgatgtggttgttatccgttatgaagggccaaaa
ggggggccgggtatgcaggaaatgctctatccgaccacttatctgaaatccatggggttg
ggcaagagttgtgccttactgaccgatggccgtttctctggcgggacatccggtttgtct
atcggccatgtgtctccagaagccgccagtggtgggttgattggtttggtacaagatggc
gatttcatcaatatcgatattccgaaccgtggcattgtcttggatgttagcgaagctgaa
ctggctgctcgccgtgaaactgaagaagcgcatggtgatgcggcctggtcaccgaagggc
cgtgagcgccaggtctcttatgccttacgcgcttacgcgatgttagcaaccagcgctgat
aaaggcgcggtgcgcgataaaagtaagctgggaggctaa

DBGET integrated database retrieval system