KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0339Help
Entry
y0339             CDS       T00092                                 

Gene name
ilvA
Definition
(GenBank) threonine deaminase (dehydratase)
  KO
K01754  
threonine dehydratase [EC:4.3.1.19]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycine, serine and threonine metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y0339 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    y0339 (ilvA)
Enzymes [BR:ypk01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     y0339 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
375629..377173
Genome map
AA seq 514 aa AA seqDB search
MAVSQPLSAAPCGAEYLRAILRAPVYEVAQVTPLQVMEKISSRVGNTVLVKREDRQPVHS
FKLRGAYAMISSLTEEQKACGVVTASAGNHAQGVALSAHKMGIKALIVMPVATADIKVDA
VRAFGGEVLLFGANFDEAKTKAIALAQEQGYTFVPPFDHPAVIAGQGTLAMELLQQDAHL
DRVFVPVGGGGLVAGVAVLIKQLMPQIKVIGVEAEDSACLRAALDAGQPVDLARVGLFAE
GVAVKRIGDEPFRLCQEYLDDVITVDSDAICAAVKDLFEDVRAIAEPSGALALAGLKKYV
QQHNIQGERLAHVLSGANVNFHGLRYVSERCELGEQREALLAVTIPEQKGSFLRFCELLG
GRSVTEFNYRYADAENACIFVGVRLTRGYAERVEILAELQDKGYQVVDLSDDEMAKLHVR
YMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHWNISLFHYRSHGTDFGRVLAAFE
LSATEPQFEERLAALGYYCHDETDNPAFKFFLAG
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcagtttcgcaacccttatctgctgccccctgcggggcagaatatctgcgggcgata
ttacgtgcgccggtgtatgaggtggcgcaagtcaccccgttacaagtgatggagaaaatc
tcctcgcgcgtgggtaataccgttttagtgaagcgtgaagatcggcagccggtacacagc
tttaagttgcgcggtgcttacgcgatgatctccagcctgacggaagagcagaaagcctgt
ggcgtcgtcacggcttctgcgggtaaccatgctcaaggcgtggcgctttctgcccataaa
atggggattaaagcgctgatcgtcatgcccgttgctactgcagatattaaagttgatgcg
gtacgtgcttttggcggcgaggtgctgctgtttggcgctaattttgatgaagccaaaacc
aaagctatcgcgcttgctcaagagcagggctacacctttgtgccaccgtttgaccatccg
gcggtgattgccgggcaggggacgctggcgatggagttactgcaacaagatgcccatctt
gatcgggtttttgtcccagtgggcggcggtgggctggtggccggtgtggcggtgcttatc
aagcaattgatgccacagattaaagtgattggtgttgaagccgaggattctgcctgtttg
cgggccgcgctggatgcggggcagccggtcgatttggcgcgtgtcgggctgtttgccgag
ggcgtggcagttaagcgtatcggtgacgagcctttccgcctgtgtcaggaatatctggac
gatgtgatcaccgttgacagtgatgctatctgtgccgcagtcaaagatctgtttgaggat
gttcgcgccattgctgagccttctggtgcgttggcattggcgggcctgaaaaaatatgtg
cagcagcataatattcagggcgagcgtctggcacatgtgctttctggtgcaaacgtgaac
ttccatggtttgcgttatgtgtcagagcgttgcgagttaggtgagcagcgtgaagccctg
ctggcggtgactattccagagcaaaagggcagtttcctgcgtttctgtgaattactgggt
ggccgttcggtaacggaatttaactaccgttacgccgatgctgaaaacgcctgcattttt
gttggggtacgtttgactcgtggttatgctgagcgggttgaaattcttgctgaattgcag
gacaaaggttatcaggtggtcgatttatctgatgacgaaatggcgaaactgcatgtgcgt
tatatggttggtgggcggccctcgaaaccactgcgtgagcgcctgttcagctttgaattc
cccgagtcaccaggcgctttgctgaaattcctgcatacgttgggcactcactggaatatt
tctctgttccactaccgcagccatggcacagattttggccgggtattggcggcatttgag
ttgtcggctaccgaaccgcaatttgaagagcgcttagcggctctgggctactattgccac
gatgaaacggataacccggcgtttaagttctttttagcgggttaa

DBGET integrated database retrieval system