KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0345Help
Entry
y0345             CDS       T00092                                 

Gene name
ilvC
Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    y0345 (ilvC)
   01230 Biosynthesis of amino acids
    y0345 (ilvC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    y0345 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    y0345 (ilvC)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     y0345 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
381832..383310
Genome map
AA seq 492 aa AA seqDB search
MANYFNTLNLRQQLAQLGKCRFMARDEFADEAGYLKGKKVVIVGCGAQGLNQGLNMRDSG
LDVAYALRKEAIAEKRASWRKATENGFKVGTYEELIPQADLVVNLTPDKQHSAVVKAVQP
LMKEGAALGYSHGFNIVEVGEQVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE
NDPKGEGMAIAKAWAAATGGHRAGVLEFSFVAEVKSDLMGEQTILCGMLQAGSLLCFDKL
VSEGTDAAYAEKLIQFGWETITEALKQGGITLMMDRLSNPAKLRAYALSEQLKEIMAPLF
QKHMDDIISGAFSSGMMADWANDDVKLLNWREETGRTAFENAPQFEGKISEQEYFDHGVL
MIAMVKAGVELAFETMVDSGIIEESAYYESLHELPLIANTIARKRLYEMNVVISDTAEYG
NYLFANAAVPLLKEKFMDSLQAGDLGKSIPGSAVDNAQLRDVNEAIRNHPIEAVGHKLRG
YMTDMKRIAVAG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctaactatttcaacacattgaacctgcgtcagcagttggcgcaattaggtaagtgt
cgctttatggcacgtgacgaatttgccgatgaagccggctacctgaaaggcaaaaaagtg
gtgattgtcggttgtggcgcacagggcctgaaccaagggttgaacatgcgtgactccggc
ctggatgtcgcttatgccctgcgtaaagaagcgattgccgagaagcgtgcttcatggcgt
aaagcgaccgaaaatggtttcaaagtaggcacttacgaagagttgatcccacaggcggat
ctggtggttaacctgacgccagacaagcagcactctgccgtggttaaggcggttcagcct
ctgatgaaagagggcgcagcactgggttactcgcatggtttcaacattgttgaagtgggt
gagcaagtgcgtaaagacatcaccgtggtgatggttgcgccgaaatgccctggtaccgaa
gttcgtgaagagtacaaacgtggttttggtgtgccgacgctgattgcggttcatccagaa
aacgaccctaaaggcgaaggcatggcgattgctaaagcctgggccgcggccaccggtggt
caccgtgcgggtgtactggaattttcttttgttgccgaagtgaaatctgacctgatgggc
gagcaaactatcctgtgtggtatgttgcaggcgggttcactgttatgtttcgacaagttg
gtttcagagggtactgatgccgcttacgctgaaaaactgattcaattcggctgggaaacc
attaccgaagcgctgaaacaaggcgggatcacgctgatgatggaccgtttgtctaatcca
gcaaaactgcgtgcgtatgcattatctgaacagttgaaagaaattatggcgccattgttc
cagaaacacatggacgacattatttctggtgcgttctccagcggcatgatggctgactgg
gctaacgatgacgttaagttgttgaactggcgtgaagagaccggcagaacggcttttgaa
aatgcgccacagtttgaaggcaagatctctgagcaggaatattttgaccacggcgtactg
atgatcgcgatggtaaaagcgggagttgagctggcattcgaaaccatggtggattccggc
attattgaagagtctgcttactacgaatctctgcacgagctgccgttgattgccaacact
atcgcccgtaagcgtctgtatgaaatgaacgtggttatctctgataccgcagaatacggt
aactacttgtttgctaatgcagcggtgccgttgctgaaagagaagtttatggattccctg
caagccggtgacttgggtaaaagtatccctggttcggcggtagataacgcacaactgcgt
gatgtgaatgaagccattcgcaatcacccgatcgaagccgttggtcataagctgcgtggt
tacatgacagatatgaagcgtattgctgttgcgggctaa

DBGET integrated database retrieval system