KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0350Help
Entry
y0350             CDS       T00092                                 

Gene name
fimD
Definition
(GenBank) outer membrane usher protein FIMD precursor
  KO
K07347  
outer membrane usher protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Pores ion channels [TC:1]
   y0350 (fimD)
Secretion system [BR:ypk02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   y0350 (fimD)
Bacterial motility proteins [BR:ypk02035]
 Pilus system
  Fimbrial proteins
   y0350 (fimD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(389158..391785)
Genome map
AA seq 875 aa AA seqDB search
MVQARVILKKNFSGRRKALTLCITLILHIDTAFGQEEPQNFEFDESLFLGTKYASGLTQL
NKKNSITAGNYDAVDVLVNNKLFKRMSVQFIKDANSSEVYPCLSDELLTAAGVELGRENS
TPPKEPHVTEANTPITETHAPTNQCLPLSTRVKGASFRFDQAKLRLELSIPQALLQKRPR
GYIERAEWQEGEKLAFINYSANAYRSDTRGQQKRTSDFGFIGLKSGINLGLWQVRQQSNV
RYASNDSGSDTQWNSIRTYVQRPIPQLDSQLTLGETFTDSTLFGSMSFLGAKMATDQRMW
PVSMRGFSPEVRGVASTNARVIIRQNGREIYETNVAPGPFVINDLFSTSSQGDLNVEVIE
ANGSRSTFTVPFSAVPDSMRPGVSRYNAVIGESRDFTNIDNYFTDFTYERGLTNQLTANS
GVRLAKDYTALLAGGVLGTPVGALGLNATYSHAKVENDKTQDGWRMQATYSQTFNQTGTT
FSLAGYRYSTKGYRDLNDVFGVRSMQKNGGTWDSSTYKQRSQFTTTINQDLGNWGQLYAS
ASTSDYYNDTARDTQLQLGYSNSYQQISYNLAVSRQRSVYTSTLYNWDSPDTDETATTTR
YGNTENIATFTVSIPLNIGSNNQYLSMSASRNPKSGNNYQTSLSGTAGERNSFNYALNAG
YDDSNFGSSSNNWGANVQKQFPNATVNGSYSRGNNYTQYGAGARGAAVIHRQGVTLGPYL
GETFGLIEANGAQGARIDSNGFALVPALTPYNYNTIGLDTKGINRNTELKENQGRVVPYA
GAAVKVKFETLTGYAVLIQAEGEGLPLGADVYNSKDELVGMVGQGNQIYARIADNKGTLD
VRWGESSGDQCQLPYAFNRQDTEQDIIHITASCRR
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcacgggtcattctgaaaaaaaatttctcaggccgtaggaaagcattaaca
ttatgtataactttaattttacatattgatactgcttttgggcaggaagaaccacaaaat
ttcgaatttgatgaatctctttttttagggacaaaatatgcatcaggtttgacccagctt
aataaaaaaaattctataactgccgggaattatgatgctgtagatgttttggttaataac
aaattgttcaaacgtatgagcgtgcaatttattaaagatgccaactcatctgaggtttat
ccctgtctgagcgacgagttattaaccgcggctggcgttgaactgggtagagaaaatagc
acccctcccaaagaaccccatgttaccgaggctaatactcccataactgaaactcacgcc
ccaacgaaccaatgtttacctctgtctacgcgggtaaaaggggcatcctttcgatttgat
caggctaaattacgtttagagctttcgattccacaggctctattacaaaaacggcccagg
ggctacattgagcgggcggaatggcaggaaggcgaaaaactcgcattcattaactacagc
gccaacgcttatcgcagtgatactcgcggccagcaaaagagaacctctgattttggtttt
attggccttaaaagtgggatcaatctgggattgtggcaagtacgccagcaatcgaacgtc
cgctacgccagtaatgatagtggcagcgatacccagtggaatagcatccgcacttatgtg
caacgcccgatcccacagttggatagccagttaacgttaggcgaaactttcactgacagt
acattatttggcagcatgtcgttcctcggtgcgaaaatggctaccgaccaacgcatgtgg
ccagtgtcaatgcgcggtttctccccagaggtccggggtgtcgccagtaccaacgcacgc
gttattattcgtcagaatggacgtgaaatttatgagacgaacgtcgctcctggcccgttc
gttattaacgatttgttcagcaccagtagccaaggcgaccttaatgttgaggttattgag
gccaatggtagccgctcgacatttacggtgccattcagtgccgttcctgattcaatgcgc
ccaggcgttagccgctataatgcggtgatcggggaatcacgcgatttcaccaatattgat
aattatttcactgacttcacctatgaacgcggcctcaccaatcaactgacggccaacagt
ggtgtccgtttagcaaaagactacacggcattacttgccggtggcgtattagggacaccg
gtcggtgctttgggcctcaatgccacctattctcacgccaaagttgaaaatgataaaacg
caagatggttggcggatgcaggccacctatagccagacctttaatcaaaccggaaccacg
ttctctttagccgggtatcgttactcaacgaaagggtatcgcgatttaaatgatgtgttc
ggggtgcgttcgatgcaaaaaaacgggggaacgtgggattcatcaacctataaacagcgt
agccaattcaccactactattaatcaagacctcggtaattggggccagttatacgcctct
gcctcaaccagtgattattataacgatacggcgagagatacccagttacagctaggctat
tcaaatagttatcagcaaatcagttacaatttggctgtcagccgccagcgcagtgtttat
acctccactctgtataactgggatagccctgataccgacgagacggcaaccaccacgcgc
tacggtaataccgagaacatcgcaacattcaccgtttctattccactgaatattggtagc
aacaaccaatatctatcaatgtcagccagccgtaatccgaaaagcggtaataactatcaa
acatcattatcaggcaccgccggtgagcgaaattccttcaactatgcattaaatgcaggc
tatgacgacagcaacttcggtagtagctcaaataattggggggccaacgtacagaagcaa
ttccccaatgctaccgttaatggcagctattctcgtggcaataattacacccaatatggc
gcaggcgctcgtggtgcggcggtaatacatcgacaaggcgtgactctgggcccttatctg
ggtgagacctttggtttaattgaagctaatggtgctcaaggggcaagaattgatagtaac
ggttttgctctggtgcccgcgctaacgccttataactacaacacaatagggctggatacc
aaggggattaaccgtaacaccgagttgaaagagaatcagggccgtgtcgtcccttatgcc
ggggcagcggtaaaagtgaaatttgaaacactgactggctatgcggtgttaattcaagcc
gaaggtgaggggttaccactgggtgccgatgtgtataacagcaaagatgaactggttgga
atggtaggtcaggggaatcagatctacgcacggatagccgataacaaaggtacacttgat
gtccgttggggcgaaagcagcggtgatcagtgtcaattaccttatgcttttaatcgccag
gataccgagcaagatatcattcatataaccgcgagttgccgccgctaa

DBGET integrated database retrieval system