KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0351Help
Entry
y0351             CDS       T00092                                 

Definition
(GenBank) chaperone
  KO
K07346  
fimbrial chaperone protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Chaperones and folding catalysts [BR:ypk03110]
 Other chaperones and cochaperones
  PapD
   y0351
Secretion system [BR:ypk02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   y0351
Bacterial motility proteins [BR:ypk02035]
 Pilus system
  Fimbrial proteins
   y0351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(391813..392568)
Genome map
AA seq 251 aa AA seqDB search
MTSEGTLIMLSIYARHYHYLFVTLLVAMSLSFANASVVMTGSRIIYPAAASEHSIQLTNN
DNFPNAVQVWLDSGDEKSTPETGKAPFIVTPPFFRIEANSGQTLRLKYTGSGLPTDRESV
FYLNFLQIPPVNKVEKDNKMLVLLRNRIKVFYRPESIIGRVDQVSTALTFSLRKQGTNLV
LTGKNPTGFYATIASGEIVSGSIKLKVKSNMIAPMSQVEWVIPNASVSSSATINFLIMND
FGGQDAGSYRI
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagaaggtacgctcatcatgcttagtatatatgcccgccactatcattatctg
tttgtaactttattagtggctatgagtctgtcttttgctaatgccagtgtcgtgatgaca
gggagtcgcatcatatatcctgcggcggcaagcgagcacagcatacagttaaccaataat
gacaatttccctaatgctgttcaggtgtggttagacagtggcgatgaaaaatcgacacca
gaaacaggcaaagccccctttatagtgactccaccgttctttcgtattgaagcaaattct
ggccaaacattacggttaaaatatacgggaagtggccttcctacagatagggaatccgta
ttttatcttaactttttacagatccctcccgtcaataaagtagagaaagataacaagatg
ttagtgctgttgcgtaaccgcattaaagtattttatcgtcccgagagtattatcggccgt
gttgaccaagtctctaccgcattgacttttagtctacgaaaacaaggaactaaccttgtt
ttgacaggaaaaaacccaactggattctatgccacaattgccagtggtgaaatcgtgagt
gggagcataaaacttaaagtaaaatcaaatatgatcgcgcctatgtctcaagttgagtgg
gtgatcccaaatgcatccgtatcctcgtcagcaacgattaactttctgatcatgaatgat
ttcggcgggcaagatgccggtagctatcgtatttag

DBGET integrated database retrieval system