KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0359Help
Entry
y0359             CDS       T00092                                 

Gene name
rhlB
Definition
(GenBank) putative ATP-dependent RNA helicase
  KO
K03732  
ATP-dependent RNA helicase RhlB [EC:3.6.4.13]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
RNA degradation
Module
RNA degradosome
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    y0359 (rhlB)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     y0359 (rhlB)
Messenger RNA biogenesis [BR:ypk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     y0359 (rhlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(400456..401742)
Genome map
AA seq 428 aa AA seqDB search
MSKTHLTEQKFSDFALHPLVVEALENKGFQYCTPIQALALPLTLSGRDVAGQAQTGTGKT
LAFLASTFHYLLSHPAEEGRQTNQPRALIMAPTRELAVQIHSDAESLSQVTGLKLGLAYG
GDGYDKQLKVLESGVDILIGTTGRLIDYAKQNYINLGAIQVVVLDEADRMYDLGFIKDIR
WLFRRMPSVDKRLNMLFSATLSYRVRELAFEQMNNAEYVEVEPLQKTGHRIKEELFYPSN
EEKMRLLQTLIEEEWPDRCIIFANTKHRCEEIWGHLAADGHRVGLLTGDVAQKKRLRILE
DFTKGDLDILVATDVAARGLHIPLVTHVFNYDLPDDCEDYVHRIGRTGRAGESGHSISLA
CEEYALNLPAIETYTGHSIPVSKYNSDALLTDLPAPKRLARTRTGNGPRRNSAPRRSGAP
RNNRKRPG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacacacttgactgaacagaagttttccgacttcgccctgcacccgctagtt
gttgaagcccttgaaaacaaagggtttcagtattgcacgccgattcaggcgttagcattg
ccactcaccctctctgggcgtgatgtagcaggtcaggcgcaaaccggtacaggcaagacg
ctggcattcttggcgtctactttccattatttgctttctcacccagcagaagagggtcgc
cagactaatcaaccacgcgcattaattatggcaccaacgcgcgaattagccgtgcaaatt
cactccgatgcagaatcactttcccaggtaaccgggctgaagttaggtctggcttatggt
ggggatggctacgataaacagcttaaagtgctggaaagtggcgttgatatcttgatcggt
acaacaggccgtttaatcgattacgcgaaacaaaattatattaacctcggtgcgattcaa
gtcgtggtattggatgaagcggatcgcatgtacgatctaggctttattaaagatatccgc
tggctgttccgccgtatgccttccgttgataaacgtttaaatatgctgttttctgccact
ctctcgtatcgggtacgtgaattggcattcgaacaaatgaataatgcagaatatgttgaa
gtggaaccgttacaaaaaaccggtcaccgcatcaaagaagagctgttctatccttcaaat
gaagaaaaaatgcgtctgttacagacgttaattgaagaagaatggcctgatcgctgtatt
atttttgctaataccaaacaccgttgtgaagagatctgggggcatttggctgctgatggt
caccgcgtcggtttattgacgggtgatgttgctcagaaaaaacgcctgcgtattctcgaa
gatttcaccaagggcgatttggatattctggttgccaccgatgttgctgcccgtggttta
cacattccattagtgacccacgtcttcaactatgacctgccagatgactgtgaagattac
gttcaccgcattggccgtactggccgtgctggcgagagtggtcactccatcagtctggcc
tgcgaagagtatgcattaaacttgccagcgattgagacctatacgggccatagcatcccg
gtaagcaaatataacagtgacgcgctattaactgatctaccagcgcctaaacgcctagcc
cgtacccgcaccgggaatggcccacgccgtaattctgccccacgccgcagtggagcacca
cggaataaccgtaagcgaccaggctga

DBGET integrated database retrieval system