KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0360Help
Entry
y0360             CDS       T00092                                 

Gene name
trxA
Definition
(GenBank) thioredoxin 1
  KO
K03671  
thioredoxin 1
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Chaperones and folding catalysts [BR:ypk03110]
 Protein folding catalysts
  Protein disulfide isomerase
   y0360 (trxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
401861..402187
Genome map
AA seq 108 aa AA seqDB search
MSDKIIHLSDDSFDTDVLKASGLVLVDFWAEWCGPCKMIAPILDEIAEEYEGRLTIAKLN
IDDNQGTAPKYGIRGIPTLLLFRDGEVVATKVGALSKGQLKAFLDANL
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataaaattattcacctgagtgacgacagtttcgatactgatgtgctgaaagcc
agcggcttggtcttagtcgatttctgggctgaatggtgtggtccgtgcaagatgattgct
ccgattttggatgaaatcgctgaagagtatgaaggtagattgactatcgctaaattgaac
attgatgataatcagggcacagcaccaaaatacggtatccgtgggattcctacgctgctg
ttgttccgtgatggcgaagttgtcgccaccaaggttggtgccttgtctaaggggcaactc
aaagcgttcttggatgcaaatctgtaa

DBGET integrated database retrieval system