KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0361Help
Entry
y0361             CDS       T00092                                 

Gene name
rho
Definition
(GenBank) transcription termination factor Rho; polarity suppressor
  KO
K03628  
transcription termination factor Rho
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    y0361 (rho)
Transcription machinery [BR:ypk03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    Transcription termination factor
     y0361 (rho)
Messenger RNA biogenesis [BR:ypk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     y0361 (rho)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
402667..403926
Genome map
AA seq 419 aa AA seqDB search
MNLTELKNTPVSDLITLGENMGLENLARMRKQDIIFSILKQHAKSGEDIFGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTVAGKIRPPKEGERYFALLKVNEVN
YDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLDLASPIGRGQRGLIVAPP
KAGKTMLLQNIATSIAYNHPDCVLMVLLIDERPEEVTEMQRLVKGEVIASTFDEPASRHV
QVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPASGKVLTGGVDANALHRPKRF
FGAARNVEEGGSLTIIATALVDTGSKMDEVIYEEFKGTGNMELHLSRKIAEKRVFPAIDF
NRSGTRKEELLTTTDELQKMWILRRILHPMGEIDAMEFLISKLATAKTNDQFFDNMRRS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaccgaattaaagaatacgccggtttctgatctgataacacttggcgaaaat
atggggctggaaaacctggcccggatgcgtaaacaagatattattttctctattctaaag
cagcatgccaaaagtggagaagatatcttcggtgacggtgtattggagatattgcaggat
ggatttggtttcctccgctctgcagacagctcctacctcgccggtcctgacgacatctat
gtatccccaagccaaattcgccgtttcaacctccgcactggtgataccgttgccggtaag
attcgtccgcctaaagaaggcgagcgttattttgcattgttgaaagttaatgaagttaac
tatgacaagccggaaaacgcccgtaataaaatcctattcgaaaacttaacgccgttacat
gccaactctcgtctgcgcatggaacgtggtaatggttcgactgaagatttaaccgcccgt
gtactggatttggcatcgccaattggtcgtggccaacgtggtctgattgtggccccacca
aaagccggtaaaactatgctgttgcagaacatcgcgaccagcattgcttacaatcaccct
gattgtgttttgatggtattgctgattgacgagcgtccagaagaagtaaccgagatgcaa
cgtctggttaaaggtgaagttattgcttctacttttgatgaaccagcatcccgtcacgtt
caagtcgctgaaatggttatcgagaaagcaaaacgtctggttgagcataaaaaagacgtt
attatcttgctggactctattacccgtttagcccgtgcttacaacaccgttgtacctgct
tcaggcaaagtattgaccggtggtgttgatgcgaacgcgttacatcgccctaaacgcttc
tttggtgccgcacgtaatgttgaagagggcggaagcctgaccatcattgcaaccgcgctg
gttgataccggttctaaaatggatgaagttatctacgaagaatttaaaggtaccggtaac
atggaattgcatctgtcccgtaaaattgcggagaaacgtgtattcccagccattgacttc
aaccgctctggtacccgtaaagaagagttgctgactacgactgatgagctacaaaaaatg
tggatcttgcgccgaattcttcatccaatgggtgaaattgatgcaatggaattcctcatc
agtaagctggcgactgcgaaaactaacgatcagttctttgataatatgagacgctcgtaa

DBGET integrated database retrieval system