KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0366Help
Entry
y0366             CDS       T00092                                 

Gene name
rffG
Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  
dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Acarbose and validamycin biosynthesis
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    y0366 (rffG)
   01055 Biosynthesis of vancomycin group antibiotics
    y0366 (rffG)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    y0366 (rffG)
   00525 Acarbose and validamycin biosynthesis
    y0366 (rffG)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     y0366 (rffG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
409316..410389
Genome map
AA seq 357 aa AA seqDB search
MALRRILVTGGAGFIGSAVVRHIIDGTSDSVVVVDKLTYAGNLESLSVVAGSERYAFEQV
DICDSSELDRVFAQYQPNVVMHLAAESHVDRSIDGPAAFIETNVVGTYTLLEAARHYWQQ
LSVEAKQAFRFHHISTDEVYGDLHGTDDLFTETTPYAPSSPYSASKASSDHLVRAWLRTY
GLPTLVTNCSNNYGPYHFPEKLIPLVILNALAGKPLPVYGNGAQVRDWLYVEDHARALYQ
VVTEGVVGETYNIGGHNERKNIEVVETICALLDELVPAKPAGIAHYRDLITYVKDRPGHD
MRYAIDAGKIERELGWRPQETFESGIRKTVLWYLNNESWWRRVQDGSYAGERLGLSD
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgaggcgaattctcgtcacaggcggggccggttttatcggctctgcggtggtc
aggcatattattgatggcacctcagatagcgtggtggtagtcgataaactcacctatgcc
ggtaatctggagtcgctgtcagtggttgcgggcagtgagcgttatgctttcgaacaagtc
gatatctgtgacagcagtgagttggatcgggttttcgcacagtatcagccgaatgtggtg
atgcatttggctgccgagagccacgttgaccgctcaattgatggccccgccgcgtttatc
gagacgaacgtggttggcacttacaccctgttggaagctgcccgtcactattggcaacaa
ctgagtgttgaagccaagcaggcgttccgctttcaccatatctcaacggatgaggtgtat
ggcgatttacacggcactgacgatttgtttaccgaaaccacgccgtatgcgccaagcagc
ccatattcggcgtctaaagcgtccagtgaccatttagtccgggcttggttgcgtacttat
ggtttaccgactttggtgactaattgttcaaataattacggcccgtatcacttcccagaa
aagctgatcccgctggttattttaaatgcgttggcgggtaagccgctgcctgtttatggc
aatggtgctcaggtccgcgactggttgtatgtagaagaccacgccagagcgttgtatcag
gtggttactgagggtgtggtgggtgaaacctacaatatcggcggccataatgagcgcaag
aatattgaagtagttgaaaccatttgcgcgctattggatgagttggtgccagcaaaaccg
gcgggtatcgcacactaccgtgatttgattacctacgtaaaagaccggccgggtcatgat
atgcgctatgccattgatgctggcaagattgagcgggaactgggttggcgtccacaagaa
accttcgaaagcggtatccgtaaaacggtcttgtggtatttgaataatgaatcttggtgg
cgtcgtgttcaggatggctcttacgccggagagcgtttgggcttgagtgactaa

DBGET integrated database retrieval system