KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0371Help
Entry
y0371             CDS       T00092                                 

Gene name
wecF
Definition
(GenBank) TDP-Fuc4NAc:lipid II Fuc4NAc transferase
  KO
K12582  
dTDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase [EC:2.4.1.325]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.325  TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase
     y0371 (wecF)
Glycosyltransferases [BR:ypk01003]
 Polysaccharide
  Bacterial polysaccharide
   y0371 (wecF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
414693..415778
Genome map
AA seq 361 aa AA seqDB search
MITLTHVLGSDIPHHNLTVLRFFNDVLAKCLPVEQVRHFMVAAKETAPFSSFPQLDINTY
SDKKALAEAVIARAQADRSARFFWHGQFNVTLWLALLSGKIKPGQVYWHVWGADLYEDAK
SLKFRLFYLLRRIAQGRVGHVFATRGDLIHYQQRHPRVPASLLYFPTRMDPALTAINIDK
PLAGPMTILVGNSGDTTNRHIEALKAIHQQFGPDVRVIIPMGYPANNEAYIEQVRQAGLA
LFSQDNLRILTEQIPFDDYLNILRECDLGYFIFNRQQGIGTLCLLTQFGVPFVLSRKNPF
WQDLAEQHIPVFFYGDTLDEPMIREAQRQLAGLDKQAIAFFNPNYIEGWKQALALAAGEH
P
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgataaccctgactcatgtactgggatctgatatcccgcaccataatctgaccgtgttg
cgtttctttaatgacgtgctggcgaaatgcctgcctgtagaacaggtacggcactttatg
gtcgcggcaaaagaaacggcccccttttcgtcattcccgcagttggatatcaacacgtac
agtgataaaaaagcgttggctgaggcggttattgcccgtgcacaggcggatcgcagtgcg
cgtttcttttggcacggtcagtttaatgtcactctctggttggcgttgctaagcggtaaa
attaagccagggcaggtgtattggcatgtctggggtgcggatttatacgaagatgccaaa
agcttaaaatttcgtctgttttacctgctgcgccgcatagcacaagggcgggttgggcac
gtgtttgccactcggggtgatttaattcattaccagcagcggcatcctcgcgtgcccgcc
tcattactctacttcccgacccgtatggatccggccctgaccgctatcaatattgataaa
cccttagctgggccgatgacaatcttggtggggaactccggtgataccactaaccgccat
atagaggcgctgaaggcgattcatcagcaatttggccctgacgtccgggtgattattccg
atgggctatccggcgaataacgaagcgtatattgaacaggttaggcaggcggggctcgca
ctgttctcgcaagacaatctacgtatcttaaccgaacagatcccctttgatgattatctg
aatattctgcgtgaatgtgatttgggctatttcatttttaaccgtcaacaaggtattggt
accctgtgtttattgacccagtttggcgtgccctttgtgctaagccgtaaaaatccgttc
tggcaagatttggctgagcagcatattcccgtgttcttctacggtgacactctggacgag
ccgatgatccgtgaggcacaacgtcaactggcagggttagataaacaagcgatcgctttc
ttcaatccaaattatattgagggctggaagcaagcgttggctctggctgcgggggaacac
ccatga

DBGET integrated database retrieval system