KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0372Help
Entry
y0372             CDS       T00092                                 

Gene name
wecF
Definition
(GenBank) TDP-Fuc4NAc:lipidII transferase
  KO
K02853  
enterobacterial common antigen polymerase [EC:2.4.1.-]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     y0372 (wecF)
Glycosyltransferases [BR:ypk01003]
 Polysaccharide
  Bacterial polysaccharide
   y0372 (wecF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
415775..417139
Genome map
AA seq 454 aa AA seqDB search
MTLGQFGGLFCIYLIAVIFILTLTYQEFRRVKFNFNVLFSMLYLLTFYFGFPLTCMLVFQ
FGVAVVPVEYLLYAMLSATAFYGIYYVTYKTRLRQPRSQPRTPIFTMNRVETNLTWVLLA
LVAVGTVGIFFMQNGFLLFKLDSYSKIFSSDVSGVALKRFFYFFIPAMLVVYFLKQDRRA
WFFFLASTVAFGILTYVIVGGTRANIIIAFSLFLFIGIVRGWITLWMLAAAGVFGIVGMF
WLALKRYGLDVNGAEAFYTFLYLTRDTFSPWENLGLLLQNYDKIDFQGLAPIVRDFYVFI
PSALWPERPDLVLNTANYFTWDVLDNHSGLAISPTLIGSLVVMGGVLFIPLGAIVVGLII
KWFDWLYEQGKAESNRYKAAILQSFCFGAVFNIIVLAREGLDSFVSRVVFFCVIFGACLV
LAKLLYWLFDTAGLIKRQGIKSNRLSTPNAGNQL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggggcaatttggcggtctattttgtatttatttgatagcagtcatttttatt
ctgacactaacctatcaggaatttcggcgggttaagtttaactttaacgttttgttttca
atgctttatctgttgaccttctattttggtttcccactgacttgtatgctggtgtttcag
tttggggtggcggtggtgccggttgagtatttgttgtacgccatgctgtctgctacggcc
ttttatggcatttactatgtcacctataaaacacggttacgtcagcctcgtagccagccg
cgcacgccaatattcaccatgaaccgggtagaaactaatctgacctgggtgctgctggca
ctggtcgcggtagggaccgtcggcatcttctttatgcaaaacggtttcttgctgtttaag
ctggattcctacagcaaaatattctccagtgatgtctctggtgtcgccctgaagcgtttt
ttctacttctttatcccggcaatgctggtggtttatttcctcaaacaggatcggcgggcc
tggttcttcttccttgccagcacggtggcgtttggcattctaacttatgtcatcgttggt
gggacgcgtgccaatatcattatcgcattctcattgttcctgtttatcggtatcgtccgt
ggatggataaccctgtggatgctagcggcggcaggtgtcttcgggattgtcggtatgttc
tggctggcccttaaacgttatggcctggatgtgaacggtgcagaggcattttacaccttc
ctctatttgacgcgggacaccttctcgccctgggaaaacctcgggttattgctacagaac
tacgacaaaatagatttccaggggctggcaccgattgtccgtgatttttatgtctttatt
ccaagcgcgctgtggccagaacgcccggatttggtactgaataccgccaattactttacc
tgggacgttttggacaatcactctgggctggctatctcgccaacgctgattggttctctg
gtggtcatggggggggtattgtttatcccgctgggggccattgttgtggggcttatcatc
aaatggttcgattggttgtatgaacaaggcaaggccgagagtaatcgctataaagcggcg
atcctgcaaagcttctgttttggggcggtgtttaatatcattgtcttggcacgtgaaggg
ctggattcctttgtctcacgagtggtatttttctgcgttatctttggtgcctgtctggta
ctggcaaaattgttgtactggttgttcgatacggcgggcttgataaagcgtcaggggatt
aaatccaaccgattatcaacgcctaacgcgggcaatcaactgtaa

DBGET integrated database retrieval system