KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0373Help
Entry
y0373             CDS       T00092                                 

Gene name
wecG
Definition
(GenBank) probable UDP-N-acetyl-D-mannosaminuronic acid transferase
  KO
K02852  
UDP-N-acetyl-D-mannosaminouronate:lipid I N-acetyl-D-mannosaminouronosyltransferase [EC:2.4.1.180]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.180  lipopolysaccharide N-acetylmannosaminouronosyltransferase
     y0373 (wecG)
Glycosyltransferases [BR:ypk01003]
 Polysaccharide
  Bacterial polysaccharide
   y0373 (wecG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
417148..417888
Genome map
AA seq 246 aa AA seqDB search
MEPNTVIPKYNVRGFEIWGFRDMAQVLDHLLGSGPVKTGTLVAMNAEKLLKAEDDTALCE
LIKNAEYLYADGISMVRAIRRKYPQAELSRVAGADLWEALMQRAGQQGTPVFLVGGKPDV
LAETEAKLRAQWNVNLVGSQDGYFTPEQREALFARIAASGAAIVTVAMGSPKQEIFMRDC
RKFYPDALYMGVGGTYDVFTSHVKRAPKIWQNMGLEWLYRLLAQPSRIRRQLKLLKFVGY
YYSGRL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaatactgtcattccaaaatataatgtccgtggctttgaaatctggggtttt
cgtgacatggctcaggtgctggatcatctactgggcagtgggccggtaaaaacgggcacc
ttggtggcgatgaatgcggaaaagctattaaaagccgaagatgatactgcactgtgtgaa
ctgatcaagaacgcggagtatctgtacgcagatggcatcagtatggttcgggctatccgc
cgtaaatatccgcaggccgagctatcacgcgttgcgggtgctgacctctgggaagccctg
atgcagcgcgctgggcagcaagggacaccagtatttttggttggcggtaagcctgatgta
ttggctgaaaccgaggcgaaattgcgtgcccaatggaacgtgaatttagtcggtagccaa
gatggctatttcacaccggagcagcgtgaagccctgtttgcccgtattgccgccagtggt
gcagcaattgtcactgtcgccatggggtctcctaaacaggagatcttcatgcgtgactgc
cgtaaattttaccctgatgccctgtatatgggggttggcggcacttacgatgttttcacc
agccatgtcaaacgtgcccccaaaatttggcagaatatggggctggagtggttataccgg
ttgctggcgcaacccagccgcattcgtcgtcagcttaagctgcttaagtttgttggttat
tattatagtggtcgtctgtag

DBGET integrated database retrieval system