KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0380Help
Entry
y0380             CDS       T00092                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00860  Porphyrin and chlorophyll metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
Module
ypk_M00121  Heme biosynthesis, glutamate => heme
ypk_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    y0380 (hemD)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     y0380 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAM83969
UniProt: Q0WAG0
Position
complement(424338..425087)
Genome map
AA seq 249 aa AA seqDB search
MTILVTRPSPAGEQLVTRLRALGRVAYHAPLIDFSPGRDLPKLPELLQDMQAGDLVFALS
QNAVRYANPLLKRNKLSWPVQLSYYAIGRTTALALHTASRLHVTFPPMGETSEMLLSLPL
LQNLAGKKALLLRGNGGRELLGASLAERGAAVTFCECYQRSPIYYDGSEQSAHWQRAGVD
ILVVTSGEMLQQIYTLVPDYYRSSWLLRCRLIVVSDRLAALATQMGWTEVRVAENADNDA
LIRALQDLQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcctggtcacccgtccatcccctgctggggagcaattagtcactcgcctgcgt
gctctgggccgggttgcctaccatgcgccattgattgatttttccccaggaagagacctg
cccaaactgccggaattattgcaagatatgcaagcgggagacttggtttttgctttatca
cagaacgcggtccgctacgctaacccgctgttaaaaagaaataaactgtcatggcctgtg
cagttatcttattatgctattggccgtacaaccgcattagcactgcataccgccagccgt
ttgcatgtcactttcccaccaatgggggagaccagtgaaatgctgctatcattgcccctg
ctgcaaaatttggccggtaaaaaggcactgttattacgcggtaatgggggccgggagttg
ctaggcgcaagcctcgcagaacgcggagcggccgtgaccttctgcgaatgctatcaacgc
agtcccatctattatgatggcagcgaacaaagtgctcactggcaacgtgccggtgttgat
attctggtggtcaccagcggcgaaatgttacaacagatctatactttagttcctgattac
tatcgttcttcctggttactgcgttgccgtttaatcgttgtgagtgatcgtttagcggcc
ttagccacccaaatggggtggacggaggtccgggtagcagaaaatgccgataatgacgca
ctgatccgtgcgttacaagaccttcaataa

DBGET integrated database retrieval system