KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0381Help
Entry
y0381             CDS       T00092                                 

Gene name
hemC
Definition
(GenBank) porphobilinogen deaminase; hydroxymethylbilane synthase
  KO
K01749  
hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    y0381 (hemC)
Enzymes [BR:ypk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     y0381 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(425084..426193)
Genome map
AA seq 369 aa AA seqDB search
MLQTYICCSHASITIVVFIATVVFLGIYPPCSYGYYTDSVHRSVIGWAVKYKTVTSMLDK
IIRIATRQSPLALWQAHYVQHLLQANHPGLQIELVPMVTRGDIILDTPLAKVGGKGLFVK
ELELALLDGRADIAVHSMKDVPIAFPEGLGLVTICEREDPRDAFVSSHYAHLDDLPAGSV
VGTSSLRRQCQLRERRPDLIIRDLRGNVGTRLAKLDNGDYQAIILAVAGLKRLGLENRIR
YAMSAEESLPAVGQGAVGIECRLDDDHTRQLLAPLNHRHTELRVCAERAMNIRLEGGCQV
PIGSYAELEGDTLWLRALVGAPDGSQMIRGERRGPAAEAEQMGIELADELLSRGAREILA
AVYLDNPAR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
ttgttacagacatacatttgttgcagtcatgcatccattacaatcgttgtattcattgca
acagttgtttttttaggcatttatccgccctgttcatacggctattacactgacagtgtt
caccggtcagtgataggatgggccgtaaaatataaaacggtaacaagcatgttagacaaa
attattcgaattgccacacgacaaagcccgctcgccttatggcaagcacattatgttcaa
catttattgcaagccaatcaccctggtctgcaaatcgaactggtcccaatggtcacccgt
ggggatatcattttggatacaccattggccaaagtcggtggtaagggtttatttgtcaaa
gaattagagctggcgctgctggacggcagagctgatattgccgtgcattcgatgaaagat
gtgcccattgctttccccgaagggctgggtttagtcacgatttgtgaacgtgaagacccg
cgcgatgctttcgtctcgtcacattatgcccatctggatgatctccctgcaggcagtgtt
gtcggtacctccagcctgcgccgccagtgtcagctacgcgaacggcgaccagacctgatt
atccgcgatctacggggcaacgtcggtacccgccttgccaaactggataatggtgactat
caggctattattctggctgtcgcgggtctcaagcgcctcggtctggaaaaccgaattcgc
tatgccatgtcagcggaggagtccctcccggctgtcggccaaggtgccgtaggtatcgaa
tgccgtctggatgatgaccatacccgccagttgctggctccgttgaaccatcggcacacc
gaattacgggtctgtgcggagcgggcaatgaatattcgccttgaagggggttgccaagtc
ccgatcggtagctacgctgaactggaaggtgatactttatggctacgggcgctggtggga
gcacctgatggcagccaaatgatccggggtgaacgccgtggtccggcggcagaggctgag
cagatgggcattgaacttgccgatgagttgctatcacgcggcgcacgagaaatcctggcg
gcggtttatctggataatcctgcgcgatga

DBGET integrated database retrieval system