KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0390Help
Entry
y0390             CDS       T00092                                 

Definition
(GenBank) transcriptional regulator
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(435754..436440)
Genome map
AA seq 228 aa AA seqDB search
MNTQNKQEGFSPSLTTIRARTRRLLIDTAMSMYERGAFPSITEVASAAQLSRATAYRYFP
TQSALVSAMVDESLGPILAWQPTQPDARQRIAELLSFAYPRMLQHEGVLRAALHLSLQQW
ADARNSDSNNNSNDSNNSSNEEKLIRGNRKRLLKLAVEPLEETLAPEALQRVIHAFSLIY
GSEVFMVLKDIWHLDEAGIQDVTQWMGKAILLQAETDSQLAAQDKTHS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgaatactcagaataaacaagaaggtttctctccatcgttaacgaccattagagccaga
acccggcggttacttattgataccgccatgtcgatgtatgaacgtggtgcattcccatca
atcaccgaagtcgccagtgcggctcagctttctcgtgctactgcttaccgttactttccg
acacaaagcgcattggtttcagccatggtcgatgagagcctcggtccaatattggcttgg
caacccacccaaccggatgcacggcagcgtatcgccgaattattgtcctttgcttatccg
cgcatgttgcaacatgaaggcgtgttacgtgcagcgctgcacttatcgctacagcaatgg
gctgatgcccgcaacagtgacagtaataacaacagcaatgacagtaataacagcagcaat
gaagaaaagttaatccgtgggaaccgtaaacgattactgaaattggccgtcgagccactg
gaagagacgttggcaccagaggccttgcaacgggtgatccatgccttttcattaatctat
ggctctgaagtttttatggtgctgaaagatatttggcatctggacgaagcggggattcag
gatgtaacccagtggatgggcaaggccattttgttgcaagctgaaaccgattcccaactg
gcggctcaggacaaaactcattcgtga

DBGET integrated database retrieval system