KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0394Help
Entry
y0394             CDS       T00092                                 

Gene name
rarD
Definition
(GenBank) hypothetical protein
  KO
K05786  
chloramphenicol-sensitive protein RarD
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   y0394 (rarD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(440638..441597)
Genome map
AA seq 319 aa AA seqDB search
MIRHAKLSTLTASPFLYSVPSHSMDKQQTRQGIFFALAAYFIWGLAPAYFKLIQQVPADE
ILTHRVIWSFFFMLILLTVSRHWPQVRDACKNRKRLLLLAVTAVLIASNWLLFIWAVNHN
HMLEASLGYFINPLVNVLFGMLFLGERFRRMQWVAVALAFAGVLIQLWQFGSLPVIGLGL
AITFALYGLLRKKLGVDAQTGMLIETMWLLPVAAVYLFFIADSPTSHLSANAWSLNLLLA
AAGVITTIPLLFFTAAATRLRLSTLGFFQYLGPTLMFILAVTFYGETIGNDKMVTFIFIW
AALLLFTLDALYTQRKLRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgccacgcaaagttaagtacactaaccgcatctcctttcttgtattctgtaccg
agccactccatggataaacaacaaactcgtcagggcattttttttgctctggctgcctat
tttatttggggccttgctcccgcgtatttcaaactcatccaacaagtgcccgctgatgag
attctgacccacagggtcatctggtcattcttctttatgttgattctgcttaccgtcagc
cgccattggccacaggtgcgcgacgcctgcaaaaaccgtaagcgcctattgttactggcg
gtgaccgccgttttgattgccagtaactggctgctgtttatctgggcggtcaaccacaat
cacatgctggaagccagtctgggatatttcattaatccgttggtcaatgtgctgtttggc
atgttatttctcggcgaacgctttcgtcgtatgcaatgggtcgccgtggcactcgccttt
gccggcgtgctgattcaactgtggcaatttggttcactgccagtgattgggctgggtctg
gccatcacctttgctttatacggcttgttgcgtaaaaagctgggcgttgatgcccaaacc
ggtatgctcattgaaaccatgtggctgctaccagtagccgccgtatatctgtttttcatc
gccgacagcccgaccagccacctgagcgccaatgcctggtcgctgaacctgctgctagcc
gctgcgggcgtcattaccacaatcccactgctgttcttcaccgcggcggccacccgtttg
cgtctttcgacactgggtttcttccagtatcttgggccaacattgatgtttattttggcg
gtgacgttctacggtgaaaccattggtaatgacaagatggtgaccttcatctttatctgg
gcggccctgctactgtttacgctggatgcactctatacccaacgcaaactacgccggtaa

DBGET integrated database retrieval system