KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0397Help
Entry
y0397             CDS       T00092                                 

Gene name
recQ
Definition
(GenBank) ATP-dependent DNA helicase
  KO
K03654  
ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
RNA degradation
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    y0397 (recQ)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     y0397 (recQ)
DNA repair and recombination proteins [BR:ypk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      y0397 (recQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
443263..445095
Genome map
AA seq 610 aa AA seqDB search
MSTAAVINRELLAVQVLRDTFGYQQFRPGQQEIINATLSGQDCLVVMPTGGGKSLCYQIP
ALVTDGLTLVVSPLISLMKDQVDQLLAYGVGAGCLNSSQTREQQLAVMDGCRSGQIKLLY
IAPERLVMESFLDQLYQWRPALLAVDEAHCISQWGHDFRPEYRALGQLKQRFPDLPVIAL
TATADEATRGDIVRLLNLDQPLIQISSFDRPNIRYTLVEKFKPLDQLWRFVQDQRGKSGI
IYCNSRAKVEDTTARLQSRGLSVAAYHAGLDNERRAQVQEAFQRDDLQVVVATVAFGMGI
NKPNVRFVVHFDIPRTIESYYQETGRAGRDGLPAEAVLLYDPADMAWLRRCLEEKPAGAQ
QDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGKQQPCGNCDICLDPPKRYDGLADAQKAL
SCVYRVGQRFGLGYIVEVLRGANNQRIREMGHDKLSVYGIGREQTHEHWVSVLRQLIHLG
LLSQNIAQFSALQLTEAARPVLRAELPLQLAVPRIQSLKVRSSANQKSYGGNYDRKLFAK
LRKLRKSIADEGNIPPYVVFNDATLLEMAEQMPITASELLSVNGVGQRKLERFGAPFMAL
IRDHVDNNDD
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaccgcagcagtgataaacagggaattactggcagtgcaggtattgcgagatact
tttggttatcagcaatttcggccagggcagcaggagatcatcaacgcgacattgtcaggc
caggattgtctggttgtgatgccaactggcggcggtaagtccttgtgttatcagatccct
gccttggtgaccgatgggctgacattggtggtttcaccgcttatctctctgatgaaagat
caggttgaccaactgttggcctatggcgtgggcgcgggttgtctaaactcatcgcagacc
cgtgaacagcaactggccgttatggatggttgccgcagtgggcagattaaattgctgtat
atcgcgccagaacggttggtgatggagagttttcttgatcaactgtatcaatggcgaccc
gccttgctggcagtggatgaggctcactgtatttcccaatgggggcatgatttccgcccg
gaataccgtgctcttggtcagttaaagcagcgtttccctgatctaccggttattgcattg
accgctacggctgatgaagcgacgcgtggcgatattgtgcgcctgttgaatctggatcaa
cctctgattcagatcagtagttttgatcgcccgaatatccgctataccttagttgagaag
tttaaacctctcgatcaactgtggcgttttgtacaagaccagcgcggcaagagcggcatt
atttactgtaatagccgagcgaaagtggaagatacgaccgcccgtttgcaaagccgtggc
ttgagtgttgccgcctatcacgccgggctggataacgagcgccgtgctcaggtgcaagag
gctttccagcgcgatgacttacaagtggtggtcgccaccgtagcgtttggaatggggatt
aacaaaccgaacgtccgctttgtcgtgcattttgatatcccacgcaccatcgaatcctac
tatcaggaaacggggcgcgccgggcgtgatggcttaccggctgaggccgtgttgttgtac
gatccggcagatatggcgtggttacgccgttgtcttgaagagaaacctgcgggtgctcag
caagatatcgaacggcataaactcaatgcgatgggggcatttgccgaagcgcaaacctgt
cgccgtttggtgctgctcaactattttggtgaaggtaaacagcagccatgcggtaactgc
gatatttgtctggatccgccaaagcgctacgatggtctggcagatgcgcaaaaggcgctc
tcttgcgtctatcgggtagggcaacgctttggcttagggtacatcgttgaggtgctgcgt
ggggcgaataaccagcgtattcgtgagatgggccatgacaagctttcggtgtacggcatt
ggccgtgagcaaacccatgaacactgggtcagcgtcttgcgccagttgatccatttgggg
ctgctcagccagaatattgcccagttctctgccttgcaactgactgaagcggcgcgcccg
gtcttacgcgcagagctgccattacaactggcggtaccgcgtattcagagcctgaaagtg
cgtagcagtgccaatcagaaatcctatggtggcaattatgatcgcaagttgttcgctaag
ctgcgcaaactgcgtaaatcaattgctgatgaaggcaatatcccgccttatgtggtgttt
aacgatgcgaccttgctggagatggctgagcagatgccgattactgccagcgagctattg
agcgtgaatggtgtcggtcagcgtaaactagaacgttttggtgcaccatttatggccctg
atccgtgatcatgtggataacaacgatgactaa

DBGET integrated database retrieval system