KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0399Help
Entry
y0399             CDS       T00092                                 

Gene name
rhtB
Definition
(GenBank) putative homoserine/homoserine lactone efflux protein
  KO
K05834  
homoserine/homoserine lactone efflux protein
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Transporters [BR:ypk02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   y0399 (rhtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(445873..446493)
Genome map
AA seq 206 aa AA seqDB search
MTLDWWLTYLLTTLILSLSPGSGAINTMSTAISHGTRGVVASIGGLQLGLAVHIVLVGVG
LGALVSQSLLAFEILKWLGAAYLIWLGIQQWRAAGSLDLHALANSMPRRKLFKRAVFVNL
TNPKSIVFLAALFPQFVLPQQPQVAQYLILGSTSVIVDIIVMIGYATLATRIARWIKSPQ
QMKLLNRIFGGLFMLIGALLATARKV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagactggtggttaacctatctgctgacaacattgatcctcagtctttctccc
ggctcgggggccattaacacaatgagcactgccatcagccatggtacccgtggggttgtt
gcttccattggcgggttacaactgggtctggcggtgcatatcgtcttggttggcgtcggt
cttggtgccctggtctctcaatccttactggcatttgaaatattaaagtggctcggtgcg
gcttacttaatttggcttggtattcaacaatggcgtgcagccgggtcgcttgacctgcat
gcactggcaaacagtatgcccaggcgtaagctgtttaaacgtgcggtgtttgttaacctg
accaatccaaaaagcattgtttttctggccgcgttatttccacaatttgtactgccacag
caaccgcaggtggcacagtatttgattttgggcagcaccagtgtgattgtcgatattatc
gtgatgattggttatgccactttggctacacgtattgcccgttggattaaatcgccacag
caaatgaaactcttgaaccgaatatttggcggcctatttatgttgattggtgcattatta
gccacagcgcgcaaagtataa

DBGET integrated database retrieval system