KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0510Help
Entry
y0510             CDS       T00092                                 

Gene name
acs
Definition
(GenBank) acetyl CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y0510 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y0510 (acs)
   00620 Pyruvate metabolism
    y0510 (acs)
   00640 Propanoate metabolism
    y0510 (acs)
  Energy metabolism
   00680 Methane metabolism
    y0510 (acs)
Enzymes [BR:ypk01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     y0510 (acs)
Lipid biosynthesis proteins [BR:ypk01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   y0510 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(577565..579529)
Genome map
AA seq 654 aa AA seqDB search
MTMSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNT
SFDPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVC
QFANVLKSLSVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDS
HSKLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWH
DLIKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPG
DIYWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAP
TAIRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTET
GGFMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLF
GDHERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVA
HPKIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHW
TDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccaaatacataaacatcctattccagctgcaattgcagagcatgctcta
attaccccagaaaaataccaacattattaccaacaatccgtgcagaaccctgatgaattc
tggggcgaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacc
tcctttgaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcg
gcgaattgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaa
ggtgatgaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgc
cagtttgctaatgtcctaaaaagtttaagcgtcaaaaaaggcgatgtggttgccatctat
atgccaatggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcatcggcgctgtt
cattccgttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattct
cactctaaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactg
aaaaaaaatgtcgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtg
gtcttccaacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcat
gacctgataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccg
ctgttcatcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacg
ggcggttatctggtttatgctgcactgacattcaaatatgtctttgattatcaccctggc
gatatctactggtgtactgcagacgttggctgggtaaccggacacagctatctgttatat
ggaccactggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggc
gtcaatcgcttaagccaagttgttgataaacataaagtcaatattctatacaccgcgcct
acagcgattcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgac
tcactgcgtattatgggatcggtcggcgagccgattaatccagaagcctgggaatggtat
tacaacaagatcggtaacagtaaatgcccgattgtcgatacttggtggcagactgaaacc
ggtggtttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaacg
cgtccattctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggg
gtggcagaaggtaatctggtcataaccgactcatggccggggcaagccagaacattattt
ggcgatcatgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtatttcagt
ggcgacggcgcacgtcgtgacgaagacggttactactggataaccggtcgagttgatgac
gtactaaacgtttcaggccatcgcttaggaacggctgaaattgaatctgcattggttgca
cacccgaaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggct
atttatgcctatatcacgctaaatcacggtgaagaaccaacgccagagttatataccgaa
gtacgcaactgggtacgtaaagagattggcccactcgcaacacccgatattttgcattgg
acggactcattacccaaaacccgttcaggcaagatcatgcgccgtattttacgcaaaatt
gcgacaggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggta
gaaaaattactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system