KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y0848Help
Entry
y0848             CDS       T00092                                 

Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Brite
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     y0848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(948237..949616)
Genome map
AA seq 459 aa AA seqDB search
MIRRGLIGGGILVIAGYLGIAGYLYMTDNTRNNTFISEAKTPNQQVSNILYQKGCDYCHT
ANASLPFYAAIPGPKQLMDYDIRQGNQHFSLEPTLLALKENRAVPEADLAKIESAIARDQ
MPPQRFNALHWSSSINAEERNQILDWVKIQRTTYFPSNSHSEMQHLALQPIPDALLVDNQ
KVALGSRLFHDPRLSGDNSISCASCHLLNKGGVDNLATSTGVDGQKGGINAPTVFNAVFN
VEQFWDGRAVDLQQQAGGPPLNPVEMASTSWEDIIAKLQQDPQLTQDFAQVYPQGYSEDT
ITDAIAEFEKTLTTPNSPFDHYLKGETQALTTSQQKGLALFQQNKCDTCHVGKNIGGQSY
EFLGLKSDYFADRQKEQTTDDLGRFNVTNDPRDMHRFKTPSLRNIALTAPYFHDAQAKDL
HQAVELMLKYQVGTQLPEQDINDIVAFLESLTGEYIPHS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaagaggattaattggtggcggtatattggtaattgcaggttatctgggtatt
gctggctatctttatatgacagataacacacgtaataacaccttcatcagcgaggcaaaa
acacccaatcagcaggtcagtaatattctttaccaaaaagggtgtgattattgccatacc
gcgaatgcatccctgccattttatgccgctatccccggccctaaacaactgatggactat
gacattcgacaaggtaaccagcatttctcattggagccaacactattagcattaaaagaa
aatcgtgccgttcctgaagcagatttagccaaaatagaatcggctattgctcgcgatcaa
atgccacctcaacgctttaacgcattacattggtcctccagcatcaacgctgaggagcga
aaccagatccttgattgggtcaaaatacaacggacgacatacttcccttccaatagccac
agcgaaatgcagcacttagcactacagccgatccccgatgccttgctggtcgacaaccaa
aaagtggcactaggttcccgcctgttccatgaccccagattatccggtgataactctatt
tcctgtgccagttgccatctgttgaacaaaggaggcgttgataatctggcgacctcaacg
ggtgtcgatggacaaaaaggtgggatcaacgcgcctacggtatttaatgccgtatttaac
gtggagcagttttgggatggccgtgccgttgatttgcagcaacaagccggtggaccacca
cttaacccagtagaaatggcctcgacctcttgggaagatataattgctaaattgcaacaa
gacccacagttgacccaggactttgcccaagtgtatccgcaaggctattctgaagacacg
atcaccgatgcaatcgctgaatttgagaaaaccctgaccacccccaacagccctttcgac
cactatctgaaaggtgaaacacaggcattaacgactagccagcaaaaaggcttggcgcta
ttccagcaaaataaatgtgatacctgccacgtcggtaaaaatattggtgggcagtcctat
gagttcttggggctaaaaagtgactatttcgctgatcgccaaaaagagcaaactaccgat
gacctcgggcgtttcaacgtcaccaacgatccacgcgatatgcaccgctttaaaacaccg
agcttgcgtaatattgccttaacagccccttattttcacgatgcacaagctaaagattta
catcaggcggttgagctaatgctcaaatatcaggtagggacccaactaccagaacaggat
atcaacgatatagtggccttcctggaaagtttgaccggggaatatattcctcattcctga

DBGET integrated database retrieval system