KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y0966Help
Entry
y0966             CDS       T00092                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypk01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ypk00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1091656..1092759
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAKGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILASADKLLLLTDQAGLYTADPR
NNPEAELIREVHGIDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQVG
VIADVIDGTPVGTRFHSLETPLENRKRWIFGAPPAGEITVDDGAVFAIMERGSSLLPKGI
RSVKGDFSRGEVIRIRNLNGRDLAHGVSRYNSDALRMLAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagacattggttgtgaaattggggacgagtgtactgaccgggggttcc
cgccgtcttaaccgtgcccatattgttgaattggtgcgtcaatgtgcccagcaacacgca
aaaggtcatcgtattgttattgtcacctctggggcgattgctgcgggtcgtgaacattta
gggtatccagagttgcccgccactattgcctcgaaacaattgctagccgcggttgggcaa
agccggttaattcagctctgggaacaactgttttcaatttatggcattcatatcggccag
atgctgctaacccgcgcagatttagaggatcgtgagcgttttcttaatgcccgcgatacc
atgaatgcgttgcttgataaccgcattgtaccggtgatcaatgagaacgacgccgtcgct
actgctgaaatcaaagtgggcgataacgataatctctccgcattggcggccattttggcc
agtgcagataagctactgttgttgaccgatcaggcggggttgtacaccgctgatccgcgt
aacaatccagaagcggagttaattcgcgaagtgcatggcattgatgatgtcctgcgcggg
atggccggagacagcgtttcggggctcgggacggggggcatggcgactaaactgcaagcg
gcggatgtcgcgtgccgtgcgggtattgatgtggtgattgccgcaggtagccaggtgggt
gtgattgccgatgtgattgacggtacgccagtcggtacccgtttccactcattggaaaca
ccattagaaaaccgtaaacgttggatttttggtgcgccaccggcaggtgaaatcacagtg
gacgacggtgctgtatttgcgatcatggaacggggcagttcgctgctgccaaaaggcatt
cgcagcgttaaaggggacttctcccgtggtgaagtgatccgtatccgtaatctcaatggg
cgggatttagcacacggtgtttcacgctataacagtgatgcattgcgcatgttagcgggg
catcactcgcaacaaatcagtgaaatcctcggatatgaatacggcccggtggctgttcat
cgtgatgatatgattgtcagctaa

DBGET integrated database retrieval system