KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y1099Help
Entry
y1099             CDS       T00092                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I and protease I and lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ypk01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1238680..1239348)
Genome map
AA seq 222 aa AA seqDB search
MLTLTDVLIKMMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAW
PSLLDKKWQATPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFP
TQDIQRDLSEIINQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFF
MEQVAVKPEWMQDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
ttgctcaccctgaccgacgtgcttattaagatgatgaacttcaagaacgttttccgctgg
catcttcccttccttttactgttgggattattcagtttgcgtgccgccgcaaccgataca
ctattgattctcggcgacagtttaagcgccggttaccgcctgcctattgcacaggcatgg
ccttcgctattggataaaaaatggcaagccacgccttcattaccgaaggtggtcaatgcc
agtatcagtggagataccgccgcgcaagggctagcgcgcttacccgctctactcaaacaa
catcagccacgctgggtgctgattgaactgggcgccaatgacgcgctgcgcgggtttccg
acgcaggacattcaacgggatctgagcgaaattatcaatcagataaccgcagcgaaagcc
cagccattattgatgcaaatccgtattccccctaactatggccgccgttatactgatgct
ttcaccgctatctatccacaactggcgcaacagttcgacatccccctactcccttttttt
atggaacaggttgccgttaagccagagtggatgcaggatgatggtttacaccctaacggc
gatgcccaaccgtttatcgcggattggatggcgcaacaactcaagccgttagttgttgat
ccgaaataa

DBGET integrated database retrieval system