KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1505Help
Entry
y1505             CDS       T00092                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y1505 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y1505 (glk)
   00052 Galactose metabolism
    y1505 (glk)
   00500 Starch and sucrose metabolism
    y1505 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    y1505 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    y1505 (glk)
   00524 Butirosin and neomycin biosynthesis
    y1505 (glk)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     y1505 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1668704..1669678
Genome map
AA seq 324 aa AA seqDB search
MMTTYALVGDVGGTNARLALCAVATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDA
CIAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEVINDFTAVSMAIPVLPAQDVLQF
GGTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQ
ELGHVSAERVLSGPGLVNLYRAIVISDARLPEKLAPKDITARALADSCTDCRRALSLFCV
IMGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDFLQDIPVYMI
THPQPGLLGAGAYLRQKLGYELSS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
ttgatgacgacttatgccctggtgggtgacgttggcggtacgaatgcccggttggcgctt
tgcgctgttgcaacgggcgagatattgcaagcaaagacatattcagggttggaatatgaa
agtttagaggatgtaatcaaacaatatctatcagagcatcaagccaaggtcaccgatgct
tgtatcgcgattgcctgcccgattaccggggattgggtcgcaatgaccaatcatacttgg
gcattttctattgccgccatgcaacagaatctgggtctggaccatttggaagtgatcaat
gacttcaccgcagtctccatggctatccccgtgttacctgcccaagatgttctgcaattt
ggtggcacacagccacagcctggcaaaccggtggcagtgtatggcgcaggtactgggctg
ggggtagcacatttagtgaatgttgatcgccgttggattagtttagcgggagagggcggg
catgttgatttcgcgcctaatagtgaagaagaagaccagattctggccgtattgcgccag
gagttggggcatgtttccgctgagcgggtgctatctgggccgggcttagtcaatttatat
cgggcaattgtgatttctgatgcgcgcctaccagagaaactggcaccgaaagatattacc
gcacgggcgctggcggatagctgtaccgattgtcgccgggcattatcactattttgcgta
attatgggccgctttgggggcaatttagcccttaacctcagtacgtttggtggcgtttat
attgcggggggcatcgtgccgcgctttatggagttctttaaagcctctggttttcgcgct
gcgtttgaagataaaggccgttttaaagatttcttacaagatattccggtgtatatgatt
actcatccacaacccggtttactgggggctggtgcctatttacgccaaaaattggggtat
gagttgtcaagctaa

DBGET integrated database retrieval system