KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1580Help
Entry
y1580             CDS       T00092                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y1580 (fadJ)
   01212 Fatty acid metabolism
    y1580 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    y1580 (fadJ)
   00650 Butanoate metabolism
    y1580 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    y1580 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    y1580 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    y1580 (fadJ)
   00310 Lysine degradation
    y1580 (fadJ)
   00380 Tryptophan metabolism
    y1580 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    y1580 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    y1580 (fadJ)
   00281 Geraniol degradation
    y1580 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    y1580 (fadJ)
Enzymes [BR:ypk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     y1580 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     y1580 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     y1580 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1746658..1748985
Genome map
AA seq 775 aa AA seqDB search
MMSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVG
DKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARV
LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGL
LPGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAG
WLNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSG
YEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIAN
VTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRG
FERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGL
HYFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINE
AARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSF
DVILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLL
GVTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRY
LDSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtc
agtgaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatccc
gcatttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggt
gacaaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaa
gcgcacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttc
attgccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgta
ttagcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtg
gctgcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagc
cgcatatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggtta
ctgcctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactg
gatatgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtg
gatgatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcgggg
tggcttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaa
gctttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccg
gcggctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggt
tatgaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcatta
cgcagcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcg
cgtgcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaac
gtaacggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaatt
aatcaggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatg
cgcccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggt
tttgaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaa
atggttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatca
tcactccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctg
cactattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaacc
agtgaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccatt
gtggtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaa
gctgcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgat
tttggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgacc
aaaataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcattt
gacgttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatat
tcaaaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaat
agctttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttg
ggggtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctg
atgttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggt
gatattggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctat
ttggatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatac
ggtgagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattc
tatcccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system