KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y1841Help
Entry
y1841             CDS       T00092                                 

Gene name
cheB
Definition
(GenBank) protein methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk02020  Two-component system
ypk02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    y1841 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    y1841 (cheB)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     y1841 (cheB)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     y1841 (cheB)
Two-component system [BR:ypk02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   y1841 (cheB)
Bacterial motility proteins [BR:ypk02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    y1841 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AAM85407
UniProt: Q8ZFM0
Position
2030847..2031899
Genome map
AA seq 350 aa AA seqDB search
MMSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAY
SELIADKIRTAAKARLPQRVLENKPAMLSHTPLLSSEKLIAIGASTGGTEAIRAVLQPLP
PTSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHLELARS
GANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGA
YTLAQNEASCVVFGMPREAIAMGGVNDVVELNQISQRMLAQISSGQALRI
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagtaaaatcagagtattgtgtgttgatgattctgcattaatgcgtcagctaatg
actgagattattaacagtcacccggatatggagatggttgctgcggcacaggatccgttg
gttgcccgtgatttgatcaaaaaatttaatccacaagttttgacgcttgacgtggaaatg
cctcgcatggatggcttggattttctcgagaaattgatgcgtctacggcccatgccggtg
gtgatggtgtcttccctaacgggtaaaaactccgaaataaccatgcgggcgttggagttg
ggggcgattgattttgtcaccaaacctcagttagggatccgcgaaggaatgctggcttac
agcgaactgattgccgataagatccgcacggcggctaaggctcgtttaccacagcgcgtc
ctggaaaataaaccggcgatgctcagccataccccattgctcagcagtgaaaaattgatc
gccattggggcatcaactggcggtactgaggcgattcgtgcggtattacagcctttgcca
ccaaccagtccggcattgctgatcactcagcatatgccgccgggatttacccgttcgttt
gctgaacgcttgaataaactgtgccaaatcacggtaaaagaagcagaggatggcgagcga
gtattaccgggacatgcctatattgcacccggtgatcggcacttggaactggcccggagt
ggtgccaactaccaggtgcggatccatgatggacccgcggttaatcgtcaccgtccttcg
gttgacgttcttttccgttcggtggcgcagtatgccgggcgcaatgcggtcggggtgatc
ctcacggggatgggcaatgatggagccgctggcttgctggagatgcaccgggcgggtgcc
tacaccctcgcgcaaaatgaggccagctgcgtggtctttggtatgccacgtgaggcgatt
gcgatggggggggttaatgacgtcgtggagttgaaccaaataagtcagcggatgttggcg
cagatcagtagtggtcaagcccttcgcatatag

DBGET integrated database retrieval system