KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y1915Help
Entry
y1915             CDS       T00092                                 

Gene name
btuE
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ypk00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ypk00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2108578..2109132
Genome map
AA seq 184 aa AA seqDB search
MSHPIYAISVQTIDHQLVKLAKYKGSVLLVVNVASQCGLTQQYEGLESLYKTYQKQGFEV
LGFPSNEFAGQEPGSDEEIHAFCRGTFGVDFPMFSKIEVNGPHRHPLYQHLVTAKPVAVK
PEGSEFYQRLASKGREPKQPGDILWNFEKFLISRDGTVLARFAPDMAPEAPILINAINQA
LASH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacccaatttacgccatttcagtgcaaacgattgatcaccagctggttaagttg
gcgaagtataaaggttccgttttattagtggtgaatgtggcttcgcaatgtggtttgact
cagcaatatgaaggattagaaagcctctataaaacctatcagaagcaaggttttgaggtt
ttaggtttcccgagtaatgagtttgcaggacaagagcctggcagtgatgaggaaattcat
gctttctgccgtggtacttttggtgtcgacttccccatgttcagtaaaattgaagtcaat
ggtccacatcggcatcctctatatcagcacttggttactgctaagcctgttgcagtgaaa
ccggaaggaagtgaattttatcaacgcctggcgagtaaaggccgtgagccaaaacagccg
ggtgatatcctatggaattttgagaaattcttgattagccgtgatggcactgtcttggcg
cgttttgctccagatatggcaccagaagcacctattttaatcaatgccatcaatcaggca
ctggctagccactaa

DBGET integrated database retrieval system