KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2047Help
Entry
y2047             CDS       T00092                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00260  Glycine, serine and threonine metabolism
ypk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y2047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    y2047 (trpA)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     y2047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NMO His_biosynth
Motif
Other DBs
NCBI-ProteinID: AAM85612
UniProt: Q8ZEH0
Position
complement(2253591..2254466)
Genome map
AA seq 291 aa AA seqDB search
MERYQQLFKQLAAKKEGAFVPFVQLGDPSPAMSLNIIDTLIAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPGICFEILAEIRQKHPTIPIGLLMYANLVFHNGIDHFYQRCAE
VGVDSVLIADVPFEESAPFRAAALRHGIAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGAENHGQLPLNHLVDKLREYNAAPALQGFGISEPAQVKASLAAGAAGAISGSAIVKI
IEKNVAQPVEMLVHANPLRHRDESGNPQLVIIYNWLLLRVSYRLELITIYR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcaactttttaagcagttagccgccaaaaaagaaggtgcctttgtt
cctttcgtccagcttggcgatccctctccggcgatgtcactcaatattattgatacgtta
attgcggcaggtgcagatgcattagagttagggattccgttctctgatccgttggctgat
ggccctaccatacaaaatgcggcgctgcgtgcctttgctgcgggtgtcactccgggtatt
tgttttgaaatactggccgaaatccgccaaaaacaccccacaatacctattggcctgttg
atgtatgcaaatctggtattccacaatggtattgatcacttctaccagcgctgtgctgag
gtgggtgtcgattcggtgctaattgctgatgtgccatttgaagagtctgcccctttccgg
gcagcggccttacgtcacgggattgcacccattttcatctgcccgcctaatgccgacgat
gacttactgcgagaaatcgcttctcatggtcgtggttatacttacctgttatcacgtgcc
ggagtcaccggtgcagaaaatcacggccagttaccgttaaaccatctggtagataaactg
cgtgaatataatgcagcgcccgcattgcagggctttggtatttcagaacccgcgcaagta
aaagccagcctggcggcgggcgcggcgggtgctatttcaggctcagcaatcgtcaaaatc
attgaaaaaaatgttgcacaacccgttgaaatgttagttcacgctaacccgcttcgtcac
agagatgaaagcggcaacccgcagctagttattatttacaattggttactattgagagtg
agttaccgtttagaattaattactatttaccgttaa

DBGET integrated database retrieval system