KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2048Help
Entry
y2048             CDS       T00092                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta protein
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00260  Glycine, serine and threonine metabolism
ypk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01130  Biosynthesis of antibiotics
ypk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y2048 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    y2048 (trpB)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     y2048 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAM85613
UniProt: Q8ZEG9
Position
complement(2254466..2255752)
Genome map
AA seq 428 aa AA seqDB search
MASQLTPLRLQIPRGYELTLVNPINQRITDRKMTTLNPYFGEFGGMYVPQILVPALKQLE
DAFVSAQLDPEFQAAFQDLLKNYAGRPTALTLCQNLTKGTKTKLYLKREDLLHGGAHKTN
QVLGQALLAKRMGKTEIIAETGAGQHGVASALACALLGLKCRIYMGAKDIERQSPNVFRM
RLMGAEVIPVHSGSSTLKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIG
EETKAQILEKEGRLPDAVLACVGGGSNAIGMFADFIDEPDVGLIGVEPAGLGIETGQHGA
PLKHGKVGIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITD
DEALDAFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQILVVNLSGRGDKDIFTVHD
ILKARGEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtcgcagctaacaccactgcggcttcaaataccaaggggatatgaacttactttg
gttaacccgataaaccaacgcataacggacagaaaaatgacgacacttaatccctatttt
ggcgaatttggcggtatgtatgtgccccaaattttagtgccagccctgaagcaactggaa
gacgcattcgtcagtgctcaactggatcctgaatttcaggccgcatttcaagatttgtta
aaaaactatgccggtcgccctaccgccctgaccttgtgtcaaaatctgaccaaagggaca
aagaccaagctatatctgaaacgtgaagatctgctgcacggcggtgcacacaaaaccaac
caggttttaggtcaggctttattagctaaacgcatgggtaaaactgaaattattgccgaa
accggtgccggccagcacggggttgcctccgcactggcttgtgcattgctgggtttaaaa
tgccgcatttatatgggggcgaaagatattgaacgtcagtcgcctaacgttttccgtatg
cgcctgatgggagccgaggttattccagtgcatagtggttcatcgacgctgaaagatgcc
tgtaatgaagcgctacgtgactggtcaggtacttatgaaaccgctcactatatgctgggt
accgccgctggccctcacccttacccgacaattgtgcgcgaattccaacgcatgatcggt
gaagaaaccaaggctcagatactggaaaaagaaggccgcctgcccgatgcagtattggcc
tgtgttggtggcggttctaatgctatcggtatgtttgctgattttattgatgagcctgat
gtgggtctgattggcgtagagcctgccggcttggggatcgaaaccgggcaacatggtgcc
cccctaaaacacggtaaggtcggtatctacttcggtatgaaatcaccgatgatgcagacc
agcgatgggcaaattgaagaatcttactctatttctgccggtctggacttcccctctgtg
gggccgcaacatgcttatttgaacagtattgggcgggctgattatgtctccattaccgat
gatgaggctttagacgcatttaagacattgtcatgtaaagaagggattattccagcgcta
gagtcctctcatgctctggcacatgcgttgaaaatgattaaagcggatccggataaagaa
caaatactggtggtgaatctctccggccggggtgacaaagatattttcaccgttcacgat
attctgaaagcacggggagagatttaa

DBGET integrated database retrieval system