KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2130Help
Entry
y2130             CDS       T00092                                 

Gene name
phoA
Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    y2130 (phoA)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    y2130 (phoA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    y2130 (phoA)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     y2130 (phoA)
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   y2130 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2352615..2354090)
Genome map
AA seq 491 aa AA seqDB search
MTVLQQGIISMNRVPTLSGIALSSGIALSTLLLSSALLTPNAIAAATGLYDRAAHGDVTQ
FGGARRLTEDQTQALRDSLSNKTVKNVILLIGDGMGDSEITSARNYAMGAGGFFKGIDAL
PLTGQYTHYALDKKTQKPNYVTDSAASATAWSSGVKTYNGALGVDVFGKDHVTLLELAKK
AGKATGNVSTAELQDATPAAQFAHVTGRKCYGPEETSEKCSTNALEKGGRGSITEQMIEG
RADVTLGGGAASFSQVAKAGEWKDQSLRDQALARGYVIVENLDDLNAIKHANQQKPLLGL
FSPGNMPVRWQGPKASYHGNLDKPPVVCENNAERTSDIPTLAVMTEKAIDLLKTNENGFF
LQVEGASIDKQDHSANPCGQFGETVDLDEAVQKALEFARADGNTLVIVTADHAHSSQIIE
PEAKAPGLTQALTTKDGAVMAISYGNSEDDSQGHTGSQLRIAAYGPHAANVVGLTDQTDL
FFTMRDAMALK
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgactgttttacaacaaggaattatatcgatgaaccgtgtacctactttatccggcata
gcattatcatccggcatagcattatcgactctgttactgtccagtgcgctattaacgcct
aatgcgattgcggctgctacgggcttatatgaccgtgctgcgcatggtgatgtgactcaa
tttggcggcgcacgtcgtttgactgaagaccaaacccaggctctgcgtgactcgttatcc
aataaaacagtaaaaaatgtcattttgttgattggagatgggatgggcgattctgaaatc
acgtctgcccgtaactatgcgatgggggccggtggtttctttaaaggcattgatgcgctg
ccgctgaccgggcaatacacgcactatgcactcgataaaaaaacacaaaaaccaaattat
gtgactgattctgctgcatcagcgacggcctggtcatctggcgtaaaaacgtataatggt
gcgttgggggttgatgtttttggtaaagaccatgttacgttgctggaactggccaaaaaa
gcaggcaaagcgacgggtaatgtctctaccgctgaactacaagatgccactcctgctgcg
cagtttgcccacgtgaccgggcgtaagtgctatggcccggaagaaaccagtgagaaatgc
agtaccaatgcattggaaaaagggggccgtggctctattactgagcaaatgattgaaggg
cgcgctgatgtcacgcttggcggtggtgcagcatcattcagccaggtcgctaaagccggt
gagtggaaagaccagtcgttgcgtgatcaggcgttggcccgcggctacgtcattgttgag
aaccttgatgacctgaacgcaataaaacacgctaatcaacagaaacctctattgggctta
ttctcgccaggtaatatgccagtgcgttggcaggggccaaaagcctcttatcatggcaat
ctggataaaccgccagtggtgtgtgaaaacaatgctgagcggaccagcgacattccaacg
ttggctgtcatgacagaaaaagccattgacctgctgaaaaccaatgagaatggcttcttc
ttgcaagttgaaggggcgtcgattgataaacaggatcactccgctaacccatgtggtcag
tttggtgaaacggttgatctggatgaagcggtacaaaaagcgctggaattcgcccgtgct
gatggcaacactttggtgattgtgacggctgaccatgctcactccagccaaattatcgag
cctgaagcgaaggctccgggcctgactcaggcattaacgaccaaagatggcgcggtcatg
gcgatcagctacggtaactctgaagacgattctcaaggccatactgggtcacaattgcgg
atagcggcttatggtcctcacgcggctaacgtcgtaggtttaactgaccaaactgatttg
ttcttcaccatgcgggatgcgatggcacttaaataa

DBGET integrated database retrieval system