KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2162Help
Entry
y2162             CDS       T00092                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    y2162
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     y2162
    3.5.1.-  
     y2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2390163..2390810
Genome map
AA seq 215 aa AA seqDB search
MKAALLLIDLQNDFCPGGALAVSEGDEVISVANRMIEACLAKNIPVIASQDWHPIEHRSF
AVNAKAEPGTVGELEGLVQVWWPVHCVQEQPGAALHPQLKQGAITAIFRKGQNPDIDSYS
TFFDNGRRAKTALDSWLQQHSIDHLYVMGLATDYCVKYSVLDALALGYQTTVISDGCRGV
NLQPQDSQLAFDAMSDAGANLLALEQCLAEVVSAD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccttgctcttaatcgatttacaaaacgacttttgtcctggtggagcgttg
gctgttagtgaaggtgatgaggtcattagcgtggctaaccgcatgattgaagcctgtctc
gcaaaaaacataccggtgattgccagccaagattggcacccaattgagcaccgtagcttt
gcggtgaacgccaaggcggagccgggcacagttggggaactagaagggttagtacaagta
tggtggccggtacattgtgttcaggaacaaccaggggcagcattgcacccacagctgaaa
caaggcgctattacagctatttttcgcaaagggcaaaaccctgatatcgacagttacagc
actttcttcgacaatggccggcgagctaaaacagcattagatagctggctacaacagcat
agcattgaccacctgtatgttatggggctggccacagattactgtgtgaaatatagcgta
ctggatgcactcgctttgggttatcaaaccacggttatcagtgatgggtgtcgtggggta
aacttgcaaccacaagacagccaactggctttcgatgcaatgagcgatgcaggcgccaac
ttactggctcttgaacaatgcctggctgaagtcgtttcagccgactga

DBGET integrated database retrieval system