KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2253Help
Entry
y2253             CDS       T00092                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    y2253 (ruvA)
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     y2253 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2483197..2483811)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGIILEKQPPLVLLETNGVGYEVQLPMTCFYELPELGQEAIIFTQFVVREDAQLL
YGFNNKQERALFRELIKVNGVGPKLALAILSGMSAQQFVGAVEREDITTLVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNNTGDISLPTASPQTSDADIEAEAASALVALGYKPQEASR
LVSKIAKPGADCETLIRDALRAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgataggccgtctcagaggtatcattctggaaaaacagccaccgctggtgctgctggaa
acaaacggtgttggctatgaagtccaattaccaatgacctgcttctatgagttacccgag
ttggggcaggaagccattatcttcacccagtttgtggtacgcgaagatgcgcagttactg
tatggtttcaataataagcaggagcgggcgctgttccgtgaattgatcaaagttaacggc
gtcgggccaaaactggctttagccattctctccgggatgtctgcacagcaatttgttggc
gcagtcgaacgtgaagatattacaacgctggtaaaactgccgggtgtcggtaaaaagacc
gccgagcggttagtggtcgaaatgaaagatcgctttaaaggccttaacggcgatctgttt
aataataccggtgatatctcgttaccaacggcttcgccacaaacctcggatgctgatatc
gaagcggaagccgcttctgcactggtcgcgctgggttataaaccacaagaggccagccgt
ttagtgagtaaaattgccaagccgggtgccgattgtgaaacactgatccgtgatgctctc
cgtgcggcgttataa

DBGET integrated database retrieval system