KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y2372Help
Entry
y2372             CDS       T00092                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypk00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ypk00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ypk00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2617134..2618156)
Genome map
AA seq 340 aa AA seqDB search
MEITDMPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIP
ADLFGICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMA
FNSVTAIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEV
YQSACETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGV
NPLTRERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLG
TFAPLLDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagataacagatatgccgacagatgatagcaataacggaattatcgactacgtatca
acaggtcatctacctgacccggaaacagtcgttaaattagtgcaagaagcccataagcga
tttagtacggatactgctggtgtggtttctaatgtttatccggcattagagagaattcct
gctgatctctttggcatttgcatggttggcactaacggcaaaatccactctgctggcgat
gtggattatgaatttaccattatgagtgtttccaaacccttcgtttttgcactggtttgt
caggctattggggcgaagaccgcccgtgaaaaactcggggttaacagtaccggtatggcg
tttaactcggtaacggccattgagcgggcatcggatggccgtacaaatccaatggttaac
tcgggtgcgattgcgacgaccagtctggttcctggcgcgaccagtgatgaacaatggaaa
ttcatttatgacggtttgtgccgctttgctggccgcgaattaacactgaatgaagaagta
taccaatcggcttgtgaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggt
tatgggcgtctggggtgtgatcctattatcgccactgatctctatacccgccagtgttca
ctgaatgtcagtgcccgagatctggctgtgatgggcgcgacattagcggacggcggcgtt
aacccactgactcgtgagcgagtggtggacaatgatatctgccattatgcattagccgtc
atggtaacggcagggctgtatgagacctctggagactggctctacgatattggcctgccc
ggtaaaagcggcattggcggtggaattgtgacagtgtcacctggcaagggagggttgggg
acgttcgcaccgttactcgacagtgcgggtaacagtatcaaagggcaacttgctgctcgg
ttcttatcacgcagtctcgggatggatatgttcgtttctgagccttacaccgaaaagaat
tga

DBGET integrated database retrieval system