KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y2462Help
Entry
y2462             CDS       T00092                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ypk00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2725976..2726968)
Genome map
AA seq 330 aa AA seqDB search
MTLQQKLTQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPVALGGNKLRKLEFLA
ADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTEQANYLTNGNRLLL
DLFNVDVVMCEALNDPNQQLAELATRVEAQGFRPYVVPIGGSNALGALGYVQCSLEIAAQ
AAGNVAFSSVVVASGSAGTHAGLAVGLQQLLPDAELIGVTVSRSADEQRPKVAQIQQALA
TSLGMTDPLAKITLWDSYFAPQYGMPNEEGIAAIKLLARLEGILLDPVYTGKAMAGLLDG
IEQQKFCDKGPILFIHTGGAPALFAYHPQV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcttcaacaaaaactgacgcaattcccgcgtctcgatctggtcggtaatgcgacg
ccattagaaaaactgtctcgtctatctgattatctgggacgtgaaatttacattaaacgt
gatgatgtcacgcctgtggcgcttggcgggaataaactgcgcaagctagaattcttagcc
gcagatgccttgagacagggagccgatacgctggttacggctggtgctattcaatctaat
catgtccgccaaaccgccgccgtggccgcgaaactggggctgcattgcgttgcgctgttg
gaaaaccccattggtactgagcaggcaaactatctgaccaatgggaaccggctgttactg
gacctattcaatgttgatgttgtgatgtgtgaggcattgaacgatccaaatcagcaatta
gcagaattggctacccgcgtggaagcgcagggtttccgcccatatgtggtaccgattggc
ggttctaatgccttgggcgcgctgggttatgtgcagtgctcactggaaattgctgctcaa
gccgcgggcaatgttgcgtttagttcggtcgtcgtggcctctggcagtgcgggaacacat
gcaggattggcggttggtctacagcagttgttacccgatgcggaattaatcggtgtgacg
gtatcacgtagtgccgatgaacagcggcctaaagtggcacagattcaacaagcgttggcg
acatcattagggatgacggacccattggcaaaaatcaccttgtgggatagttattttgcc
ccgcaatatgggatgccaaacgaagaggggatagcggctattaagctcttggcaagactg
gaaggaatattgttggaccctgtgtataccggtaaggcgatggcgggcttacttgatggt
attgaacagcaaaaattctgcgacaaagggccaattttatttatccacactggcggggca
cctgcgctgtttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system