KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2462Help
Entry
y2462             CDS       T00092                                 

Definition
(GenBank) putative 1-aminocyclopropane-1-carboxylate deaminase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    y2462
Enzymes [BR:ypk01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     y2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2725976..2726995)
Genome map
AA seq 339 aa AA seqDB search
MIHQFLGGHVTLQQKLTQFPRLDLVGNATPLEKLSRLSDYLGREIYIKRDDVTPVALGGN
KLRKLEFLAADALRQGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTEQANY
LTNGNRLLLDLFNVDVVMCEALNDPNQQLAELATRVEAQGFRPYVVPIGGSNALGALGYV
QCSLEIAAQAAGNVAFSSVVVASGSAGTHAGLAVGLQQLLPDAELIGVTVSRSADEQRPK
VAQIQQALATSLGMTDPLAKITLWDSYFAPQYGMPNEEGIAAIKLLARLEGILLDPVYTG
KAMAGLLDGIEQQKFCDKGPILFIHTGGAPALFAYHPQV
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattcatcaattccttggggggcacgtgacgcttcaacaaaaactgacgcaattcccg
cgtctcgatctggtcggtaatgcgacgccattagaaaaactgtctcgtctatctgattat
ctgggacgtgaaatttacattaaacgtgatgatgtcacgcctgtggcgcttggcgggaat
aaactgcgcaagctagaattcttagccgcagatgccttgagacagggagccgatacgctg
gttacggctggtgctattcaatctaatcatgtccgccaaaccgccgccgtggccgcgaaa
ctggggctgcattgcgttgcgctgttggaaaaccccattggtactgagcaggcaaactat
ctgaccaatgggaaccggctgttactggacctattcaatgttgatgttgtgatgtgtgag
gcattgaacgatccaaatcagcaattagcagaattggctacccgcgtggaagcgcagggt
ttccgcccatatgtggtaccgattggcggttctaatgccttgggcgcgctgggttatgtg
cagtgctcactggaaattgctgctcaagccgcgggcaatgttgcgtttagttcggtcgtc
gtggcctctggcagtgcgggaacacatgcaggattggcggttggtctacagcagttgtta
cccgatgcggaattaatcggtgtgacggtatcacgtagtgccgatgaacagcggcctaaa
gtggcacagattcaacaagcgttggcgacatcattagggatgacggacccattggcaaaa
atcaccttgtgggatagttattttgccccgcaatatgggatgccaaacgaagaggggata
gcggctattaagctcttggcaagactggaaggaatattgttggaccctgtgtataccggt
aaggcgatggcgggcttacttgatggtattgaacagcaaaaattctgcgacaaagggcca
attttatttatccacactggcggggcacctgcgctgtttgcttatcatccgcaggtgtag

DBGET integrated database retrieval system