KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y2582Help
Entry
y2582             CDS       T00092                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ypk00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypk00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ypk00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2843886..2846066
Genome map
AA seq 726 aa AA seqDB search
MSPPCHHLEQIFVFTGAIMNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEA
LNRPVANSRLDSDIPLTLCPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTII
SEDTSAGLRLVSELQMCPDSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNG
RWIKEFQRHSLKLDHGGYIQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLAWSGNH
RLRADCKSDGRRQVQAEALYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQ
NIVPSLAEKPRPVHLNTWEGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLS
SLGDWYIDAEKYPQGLNPIIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYP
LLKGRDQLLLDLSNPAVFDYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQT
EQLYRLFDQLNLHFPHIEFESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSY
FFPPEVMGAHIGGTPCHTTARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIAL
HKQLRPLLHSGNTIRLDHPDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLN
PSTHYQIEVLDMPDSMHKPRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILI
QLSAVN
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgccatgccatcacctcgagcaaattttcgttttcacaggagccattatgaat
actacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctctccctac
gcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatggaagcc
ttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctctgccct
gaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggcgaagat
tggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacgattatt
agcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgcccagacagt
ggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccgaatcgat
cggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttcaatggc
cgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttatattcag
gaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtagggaaagca
ggcttcagtgagcaacagggcgaggtctggggcttgcatctggcctggagtggaaaccat
cgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagccctctat
ttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtctacgcg
acctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtgcgccag
aatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgggaaggc
atctattttaagcatgacccagactacattattcagatggtgaaaaacgcggccaaaatt
ggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgatttaagt
tcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaaccccattatt
gaagcagtgaatgaatacggtatggagtttggtatctgggtggagcctgaaatgatcaat
caggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggctacccg
ctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttcgactac
ctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaatgggat
ttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaacagacc
gagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaatttgaa
tcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccaccgtttc
tggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatgagctac
ttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccataccaccgcc
agaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggggtcgag
cttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatattgcgcta
cataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccatccggat
aaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtcctgatc
agccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggtcttaac
ccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaaccacga
aataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagtggcgat
tggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatcctgata
cagctttcagccgtaaattaa

DBGET integrated database retrieval system