KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2582Help
Entry
y2582             CDS       T00092                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    y2582
  Lipid metabolism
   00561 Glycerolipid metabolism
    y2582
   00600 Sphingolipid metabolism
    y2582
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     y2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2843886..2846066
Genome map
AA seq 726 aa AA seqDB search
MSPPCHHLEQIFVFTGAIMNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEA
LNRPVANSRLDSDIPLTLCPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTII
SEDTSAGLRLVSELQMCPDSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNG
RWIKEFQRHSLKLDHGGYIQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLAWSGNH
RLRADCKSDGRRQVQAEALYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQ
NIVPSLAEKPRPVHLNTWEGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLS
SLGDWYIDAEKYPQGLNPIIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYP
LLKGRDQLLLDLSNPAVFDYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQT
EQLYRLFDQLNLHFPHIEFESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSY
FFPPEVMGAHIGGTPCHTTARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIAL
HKQLRPLLHSGNTIRLDHPDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLN
PSTHYQIEVLDMPDSMHKPRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILI
QLSAVN
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgccatgccatcacctcgagcaaattttcgttttcacaggagccattatgaat
actacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctctccctac
gcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatggaagcc
ttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctctgccct
gaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggcgaagat
tggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacgattatt
agcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgcccagacagt
ggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccgaatcgat
cggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttcaatggc
cgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttatattcag
gaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtagggaaagca
ggcttcagtgagcaacagggcgaggtctggggcttgcatctggcctggagtggaaaccat
cgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagccctctat
ttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtctacgcg
acctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtgcgccag
aatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgggaaggc
atctattttaagcatgacccagactacattattcagatggtgaaaaacgcggccaaaatt
ggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgatttaagt
tcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaaccccattatt
gaagcagtgaatgaatacggtatggagtttggtatctgggtggagcctgaaatgatcaat
caggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggctacccg
ctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttcgactac
ctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaatgggat
ttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaacagacc
gagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaatttgaa
tcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccaccgtttc
tggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatgagctac
ttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccataccaccgcc
agaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggggtcgag
cttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatattgcgcta
cataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccatccggat
aaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtcctgatc
agccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggtcttaac
ccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaaccacga
aataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagtggcgat
tggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatcctgata
cagctttcagccgtaaattaa

DBGET integrated database retrieval system