KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y2631Help
Entry
y2631             CDS       T00092                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00040  Pentose and glucuronate interconversions
ypk00052  Galactose metabolism
ypk00500  Starch and sucrose metabolism
ypk00520  Amino sugar and nucleotide sugar metabolism
ypk01100  Metabolic pathways
ypk01130  Biosynthesis of antibiotics
Module
ypk_M00362  Nucleotide sugar biosynthesis, prokaryotes
ypk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    y2631 (galU)
   00052 Galactose metabolism
    y2631 (galU)
   00500 Starch and sucrose metabolism
    y2631 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    y2631 (galU)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     y2631 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAM86185
UniProt: A0A0H2W4X0
Position
complement(2894669..2895559)
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVDECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKNICPADVTIMQVRQGHAKGLGHAVLCAKSM
VGDNPFIVMLPDVLLDDSTADLSKENLASMIKRFEETGHSQIMVEPVPKADVSKYGIADC
GHVALAPGESTLMTAVVEKPSIAEAPSNLAVVGRYVLSKNIWPLLEKTPRGAGDEIQLTD
AIAMLMQQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHHTEGEKFTAWLKQQLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaaaagccgtcattcctgttgctgggcttggcacccgtatgttgcccgcg
actaaagctattccgaaagaaatgctcccggtcgtcgataaacccctgatccagtatatt
gtggatgaatgtgttgccgcaggggtcaaagagatcgtactggtgagccattcatctaag
aatgcgatagagaatcattttgatacttcatttgagctggaagccgcgctggagtcacgg
gttaagcggcagttattaaaagagatcaaaaatatttgcccagcggatgtcaccattatg
caagtgcggcagggccatgctaaaggtctagggcacgcagtgttatgtgctaaatcgatg
gtgggggacaatccttttatcgtcatgctaccggatgtactactggacgattcaacggct
gatttatcaaaagaaaatcttgccagtatgattaaacgcttcgaagaaaccggtcatagc
caaatcatggttgagccagtgcccaaagcggatgtctccaaatacggtattgcggattgt
ggccatgtggcattagcaccaggcgaaagcacgttgatgacagcggtggtagaaaaaccc
tctatagccgaggccccgtctaaccttgctgtagttgggcgctatgtattgtctaaaaat
atctggccgttgcttgagaaaacaccacgtggtgcgggggatgaaattcaactgaccgat
gccattgcgatgttaatgcagcaagagcccgtagaggcatttcatatgacgggcaaatct
catgattgcggcgataaactgggctatatgaaagcttttgtgacttatggcgttcgtcat
catactgaaggtgaaaagtttactgcctggctaaaacagcaactcgattaa

DBGET integrated database retrieval system