KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3048Help
Entry
y3048             CDS       T00092                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    y3048 (gpmA)
   01230 Biosynthesis of amino acids
    y3048 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    y3048 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    y3048 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y3048 (gpmA)
Enzymes [BR:ypk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     y3048 (gpmA)
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   y3048 (gpmA)
  Exosomal proteins of melanoma cells
   y3048 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3355653..3356489
Genome map
AA seq 278 aa AA seqDB search
MIRLIERSQRTCSLKYDGHIPNLIGVNVMAVTKLVLVRHGESQWNNENRFTGWYDVDLSE
KGRSEAKAAGKLLKDEGFTFDFAYTSVLKRAIHTLWNILDELDQAWLPTEKTWKLNERHY
GALQGLNKSETAEKYGDEQVKQWRRGFAITPPALEKSDERFPGHDPRYAKLTDAELPTTE
SLALTIERVIPYWNDVIKPRIASGERVIIAAHGNSLRALVKYLDDLGEDEILELNIPTGV
PLVYEFDENFKPIKHYYLGNADEIAAKAAAVANQGKAK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgattcggctgattgagcgcagccaacgcacatgcagcttgaagtatgacgggcatata
ccaaacttaattggagtcaacgttatggcagtaactaagctagttttggtacgacacggc
gaaagtcaatggaacaacgaaaaccgcttcaccggttggtatgatgttgatctgtctgaa
aaaggccgttctgaagcaaaggcagcgggtaagctgttaaaagatgaaggcttcactttt
gatttcgcctacacctcagtattaaaacgcgctatccacaccttgtggaacattttggat
gaattagatcaggcatggctgccaacagaaaaaacctggaagcttaacgagcgtcactac
ggcgcactgcaaggcctgaataaatctgaaacggctgaaaaatacggcgatgagcaggtt
aagcaatggcgtcgtggctttgccatcacccctccagcactggagaaaagcgatgagcgt
ttcccaggccatgacccacgttatgcaaaattgactgatgctgagctgccaaccacagaa
agcttggcgctgactattgaacgcgtgattccctactggaatgacgttatcaaaccacgt
attgccagcggtgaacgcgtaattattgctgctcacggtaactctttacgtgcattggta
aaatatctggatgatctgggcgaagacgaaattcttgagctgaacatcccaactggcgtg
ccattagtgtatgagtttgatgagaacttcaagcctatcaaacactactatctgggtaac
gctgatgaaatcgccgctaaagctgcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system