KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3715Help
Entry
y3715             CDS       T00092                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y3715 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    y3715 (thrC)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     y3715 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4130524..4131813)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRV
LRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLPADFAQM
RAFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcataacgagcaggtcagcttcgcacaggcgatcaaa
caaggcttgggcaaacagcaggggctatttttcccgttggagttgcccgagttcgaactg
actgagatcgataaactgctggatctggattttgtgacccgtagtagccgcattctgtcg
gcttttattggtagtgaaattgcaccagatgtcttaaccaaacgtgtgcaggcagctttt
gaattcccagcccctgttgcacaagttgaaaatgatatcgccgttctggagttgttccac
ggcccgaccttggcgtttaaagactttggcgcacgttttatggcacagatgctggccgaa
gttgctggcgatcaacccgtcactattttaacggcaacatcgggtgatactggtgcggcg
gtggctcatgcattctacgggctgaaaaatgttcgagtggttatcctttatccacgaggc
aagattagtccgctgcaagaaaagctgttttgtactctgggcggtaatattcacacggtg
gcgattgatggcgattttgatgcttgtcaggcactggttaagcaagcttttgatgatgaa
gaactgaaaaccgcgctgagtttgaattccgctaactcaattaatatcagccggttactg
gcacaaatttgttactactttgaagctgtagcccagttaccacaagaggcgcgcaaccaa
ctggttatctctgtaccaagcggtaactttggtgatttgactgccggtttgttggcaaaa
tctttagggctaccggtgaaacgctttattgctgccactaatgctaacgacaccgtgcca
cgctttttggttaacggccagtggcagccaaagccaactgtagccacgttatcgaatgcc
atggatgtcagtcagccaaataattggccacgtgtggaagagctatatcgtcgcaaaatc
tggcagttgaaggatttagggcatggtgcggttagcgataaaaccacaaaagatacgatg
cgtgaattagctggtttggggtatatctctgagcctcacgcggcgattgcttaccgtgta
ttgcgtgatcagttgcaagatggtgaatttggcttgtttatcggaaccgcacatcccgcg
aaattcaaagagagcgtagaggcaattctgggtcaggaattacctttaccaaaaccactg
gccgtgagagcgcaattaccgttgctatcccatgatttgcccgcagactttgcacaaatg
cgggcatttttgatggcattgccgaagtaa

DBGET integrated database retrieval system