KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3715Help
Entry
y3715             CDS       T00092                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
ypk00260  Glycine, serine and threonine metabolism
ypk00750  Vitamin B6 metabolism
ypk01100  Metabolic pathways
ypk01110  Biosynthesis of secondary metabolites
ypk01120  Microbial metabolism in diverse environments
ypk01230  Biosynthesis of amino acids
Module
ypk_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    y3715 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    y3715 (thrC)
Enzymes [BR:ypk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     y3715 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AAM87263
UniProt: Q0WJK5
Position
complement(4130524..4131813)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILS
AFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAE
VAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTV
AIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNA
MDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRV
LRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLPADFAQM
RAFLMALPK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataaccttaaagatcataacgagcaggtcagcttcgcacaggcgatcaaa
caaggcttgggcaaacagcaggggctatttttcccgttggagttgcccgagttcgaactg
actgagatcgataaactgctggatctggattttgtgacccgtagtagccgcattctgtcg
gcttttattggtagtgaaattgcaccagatgtcttaaccaaacgtgtgcaggcagctttt
gaattcccagcccctgttgcacaagttgaaaatgatatcgccgttctggagttgttccac
ggcccgaccttggcgtttaaagactttggcgcacgttttatggcacagatgctggccgaa
gttgctggcgatcaacccgtcactattttaacggcaacatcgggtgatactggtgcggcg
gtggctcatgcattctacgggctgaaaaatgttcgagtggttatcctttatccacgaggc
aagattagtccgctgcaagaaaagctgttttgtactctgggcggtaatattcacacggtg
gcgattgatggcgattttgatgcttgtcaggcactggttaagcaagcttttgatgatgaa
gaactgaaaaccgcgctgagtttgaattccgctaactcaattaatatcagccggttactg
gcacaaatttgttactactttgaagctgtagcccagttaccacaagaggcgcgcaaccaa
ctggttatctctgtaccaagcggtaactttggtgatttgactgccggtttgttggcaaaa
tctttagggctaccggtgaaacgctttattgctgccactaatgctaacgacaccgtgcca
cgctttttggttaacggccagtggcagccaaagccaactgtagccacgttatcgaatgcc
atggatgtcagtcagccaaataattggccacgtgtggaagagctatatcgtcgcaaaatc
tggcagttgaaggatttagggcatggtgcggttagcgataaaaccacaaaagatacgatg
cgtgaattagctggtttggggtatatctctgagcctcacgcggcgattgcttaccgtgta
ttgcgtgatcagttgcaagatggtgaatttggcttgtttatcggaaccgcacatcccgcg
aaattcaaagagagcgtagaggcaattctgggtcaggaattacctttaccaaaaccactg
gccgtgagagcgcaattaccgttgctatcccatgatttgcccgcagactttgcacaaatg
cgggcatttttgatggcattgccgaagtaa

DBGET integrated database retrieval system