KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3752Help
Entry
y3752             CDS       T00092                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    y3752 (holD)
   00240 Pyrimidine metabolism
    y3752 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    y3752 (holD)
   03430 Mismatch repair
    y3752 (holD)
   03440 Homologous recombination
    y3752 (holD)
Enzymes [BR:ypk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     y3752 (holD)
DNA replication proteins [BR:ypk03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     y3752 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4171292..4171729)
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQLPEHGDPLLCDVLRS
LGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLHSPELAGLYQDAGAKRA
LWQQICHYEADFYPDASRSGHSIPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttgctgttacagcagcttggcattacgcagtgggtattgcgc
cgtcctgccgtcttgcagggtgagattgcaatacatttacctgaagatacccgcctactg
attgtggcacagcaactgcctgaacacggtgatccactgttgtgcgatgtgctacgcagt
ttgggcctaaccccccatcaggtttatgccttgacgccggatcaggtcgcgatgttgccg
gaagatacgcagtgcaacagttggcgattgggcatcagtgagccgcttgcggtggccggt
gcacaattacatagcccagaattagctgggctttatcaagatgcgggcgctaagcgcgca
ctttggcagcagatttgtcattatgaagcagatttctatcctgacgccagccgatctggc
cacagcataccaaattga

DBGET integrated database retrieval system