KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y3757Help
Entry
y3757             CDS       T00092                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ypk00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ypk00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4175692..4176777)
Genome map
AA seq 361 aa AA seqDB search
MPINALSKTLLLGLISFAALGEVSAAQYNAVVSAMAQGDEFSSINAALQSAPPDSSPFVI
FLKKGVYTERLEVNRDNVTLKGEERDTTVIGANTAAGMLNPQGTKWGTSGSSTVLVNAAN
FTAENLTIRNDFDFPANQAKAEGDPTKLKDTQAVALLLAEKSDKARFRQVKLEGYQDTLY
SKTGSRSYFTDCDISGHVDFIFGSGVTVFDRCNIIARDRRDISPPYGYITAPSTQNTAPY
GLIVLNSRLTKEPGVPAKSFALGRPWHPTTAFDDGRYADPAAIGQAVFINTVMDDHIYGW
DKMSGKDKQGEKVWFYPQDSRFFEANNQGPGAEINEGRRQLSAEQLKAFTLPMIFPDWTV
Q
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgccaattaatgctctgagtaagacactattattaggattgatatcatttgccgcttta
ggtgaagtcagcgcggcacagtacaatgctgtggtttctgccatggcgcagggcgatgag
ttctcttcaattaatgcagcgttacaatcagcaccgccagatagttctccgtttgttatt
ttccttaaaaaaggcgtttataccgaacggcttgaggtcaatcgtgacaatgtgacgctg
aaaggtgaggagcgtgatacgacggtgattggcgcgaataccgccgcgggtatgctcaac
ccacaagggacgaagtggggaacctctggcagcagcacggtattggtgaatgccgccaat
tttactgcagaaaatttgacgattcgtaatgacttcgatttccctgctaatcaggcgaaa
gcagagggtgatccgacgaaattaaaagatacgcaggcggtggcgctgttattagcagaa
aaaagtgataaagcccgtttcaggcaagtcaaacttgaggggtaccaagatacgctttat
agcaaaacgggcagtcgtagctactttaccgattgtgacatcagtggccacgtcgatttt
atttttggctcaggggtgacggtatttgaccgctgcaatattattgcccgtgatcgccgt
gatatctccccaccttacggttacattacggcacccagtacccaaaataccgcaccttat
ggtctgattgtcctcaatagtcgtttaaccaaagaaccaggtgtgcctgctaaaagtttt
gccttagggcgcccgtggcaccctactacagcatttgatgatggccgttatgctgatcct
gcggctatcggacaggcggtatttatcaataccgtaatggatgatcatatttatggctgg
gataaaatgtctggaaaagataagcaaggcgagaaagtttggttctacccgcaagactct
cgcttctttgaagcgaacaatcagggaccaggggctgaaattaatgaggggcggcgtcag
ttgtctgctgagcaactaaaagcgttcacattgccaatgatttttccagactggaccgtt
cagtaa

DBGET integrated database retrieval system