KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3831Help
Entry
y3831             CDS       T00092                                 

Definition
(GenBank) putative endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4261870..4262790
Genome map
AA seq 306 aa AA seqDB search
MVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYN
LLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLP
PQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDA
ILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAAL
LPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQP
SWHRQR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggatgatcagccgatgtttgagcgtttattggcttggacagaaaacaatctg
gcagccggtgatctcacttcccgccttcccgcttggttatgggggcaaaactcacaaaat
aactgggatattctggaccctaattcggcctccgatgcggatatcttgattgcctacaac
ttgctggaggctggcaggttatggggtaaccgccgttacctgattatgggtaccttatta
ctgcaacgtattgcgcaagaagaagtcatggatattcccggccttggccagatgctatta
ccgggaaaaattggttttaacgatgaggatacctggcgtctcaacccaagttatttaccg
ccacaactactggcacgattttcctccatagacgggccttgggaagcgatggtagaagtg
aatcagcgtatgtggctggaaaccgcaccaaacggtttttcgctggactgggtggtctgg
cagaaaggtaaaggctggcagcccgataccataaaaccggatgtcggcagtaacgatgcc
attctggtttatctgtgggcggggatgctggcaatggacagcccacaaaaagctgaattg
attgcgcgttttcagccaatggcggtaatcactcagcagcaaggcctgccaccgtttacg
accaacagcgacaatggtaaaactaacggggatggggcagtgggtttttctgcggcatta
ttgccctttttagccagcagcccagaaccgtttaatcagcaaacactgaatctccaacag
cgacgggtacaaaattcaccgcctggcgctgatgattattacagtgctattctgaccctg
tttggtcaggggtggttacagcatcgttatcattttacccatcagggagagctacagccc
tcatggcaccgtcaacgttaa

DBGET integrated database retrieval system