KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3831Help
Entry
y3831             CDS       T00092                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    y3831
Enzymes [BR:ypk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     y3831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4261870..4262790
Genome map
AA seq 306 aa AA seqDB search
MVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYN
LLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLP
PQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDA
ILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAAL
LPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQP
SWHRQR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggatgatcagccgatgtttgagcgtttattggcttggacagaaaacaatctg
gcagccggtgatctcacttcccgccttcccgcttggttatgggggcaaaactcacaaaat
aactgggatattctggaccctaattcggcctccgatgcggatatcttgattgcctacaac
ttgctggaggctggcaggttatggggtaaccgccgttacctgattatgggtaccttatta
ctgcaacgtattgcgcaagaagaagtcatggatattcccggccttggccagatgctatta
ccgggaaaaattggttttaacgatgaggatacctggcgtctcaacccaagttatttaccg
ccacaactactggcacgattttcctccatagacgggccttgggaagcgatggtagaagtg
aatcagcgtatgtggctggaaaccgcaccaaacggtttttcgctggactgggtggtctgg
cagaaaggtaaaggctggcagcccgataccataaaaccggatgtcggcagtaacgatgcc
attctggtttatctgtgggcggggatgctggcaatggacagcccacaaaaagctgaattg
attgcgcgttttcagccaatggcggtaatcactcagcagcaaggcctgccaccgtttacg
accaacagcgacaatggtaaaactaacggggatggggcagtgggtttttctgcggcatta
ttgccctttttagccagcagcccagaaccgtttaatcagcaaacactgaatctccaacag
cgacgggtacaaaattcaccgcctggcgctgatgattattacagtgctattctgaccctg
tttggtcaggggtggttacagcatcgttatcattttacccatcagggagagctacagccc
tcatggcaccgtcaacgttaa

DBGET integrated database retrieval system