KEGG   Yersinia pestis KIM10+ (biovar Mediaevalis): y3886Help
Entry
y3886             CDS       T00092                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ypk  Yersinia pestis KIM10+ (biovar Mediaevalis)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:ypk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    y3886 (glgB)
Enzymes [BR:ypk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     y3886 (glgB)
Exosome [BR:ypk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   y3886 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4336512..4338695
Genome map
AA seq 727 aa AA seqDB search
MSVLPDRQVINQLISGHYGDPFSILGMHETSQGLQICALLPDAREVWLVETENGRRIAQL
TLEDPRGFFIAQLTRRKKSFRYQFAVTWQENPQIIEDPYRFGPLLQDIDSWLLAEGTHLR
PYERLGAHLMSLDGVSGVSFAVWAPNAQRVSVVGDFNFWDGRRHPMRLRRENGIWELFLP
GIEAGQLYKFEIIDCHGQVRLKADPYAFEAQMRPETASLISPLPDVVKSSAARQKANDLC
SPVSIYEVHLGSWRRHTDNNFWLSYRELADQLVEYVKYMGFTHVELLPINEHPFDGSWGY
QPLGLYAPTRRYGTPEDFKAFVAKFHQAGINVILDWVPGHFPSDEHGLSTFDGTALYEYA
DPREGYHQDWNTLIYNYGRNEVRNYLAGNAFYWMERFGIDALRIDAVASMIYRDYSRAEG
QWVPNYYGGRENLEAIAFLRYTNKTIGVERPGSVTMAEESTDFPGVTLPPDIGGLGFNYK
WNMGWMHDTLNYMQCDPVHRKYHHNLMTFGMLYAYTENFILPLSHDEVVHGKRSILDRMP
GDAWQKFANLRAYYAFMWAHPGKKLLFMGCEFAQGREWNFETSLDWHLLDDENGWHSGVQ
RLVRDLNHCYRQYAPLYEWDYQPAGFEWLVVDDHENSVFAFLRRDAEGHELIAISNFTPV
PRYHYRVGIPQGGHYREVLNSDSAFYCGSNLGNQGGIDSHHVRSHNHEHSLLLTLPPLAT
IYLLREN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacttcccgatcgtcaggtgattaatcagcttatttccggccattatggcgac
cccttctccattttgggtatgcatgaaacctcgcaggggttgcagatttgtgcattgctg
ccagatgcccgagaagtctggctagtggagacagagaacgggcggcggatagcacaatta
acgctcgaagatccccgtggtttttttattgcacaactgactcgtcgtaagaaatccttc
cgctaccaatttgccgttacctggcaagagaacccacaaatcatcgaagatccttaccgt
ttcggtcccttattacaggatattgatagctggttattggctgaaggtacccatttacgc
ccttatgaacgtttgggggcgcatttaatgagccttgatggtgtatccggtgtcagtttt
gcggtttgggcaccgaatgctcagcgggtatccgtggtgggggattttaacttttgggat
ggccgccgccatccgatgcgcttacggcgtgaaaatggcatttgggagctatttctgcca
ggaatagaggcggggcagttgtataagtttgagatcattgattgccatggccaggtgcgt
ctgaaagctgacccttacgcttttgaagcgcagatgcggccagaaaccgcctcattgatt
agcccgctacccgatgtagtgaagagtagcgccgcacggcaaaaagccaatgatttatgt
tccccggtgtctatctatgaagtgcatctcggttcgtggcgtcggcataccgataataat
ttctggttgagttaccgcgaattggcggatcaactggtcgaatacgttaaatatatgggt
tttacccatgtcgagctgctgccgattaacgaacatccatttgacggtagctggggttat
cagccgctaggattatatgcaccgacccgccgttacggcaccccagaggatttcaaagcg
ttcgtcgccaaattccatcaggcaggaattaacgtgatccttgattgggttcccggccat
tttcccagtgatgagcatggattatcgaccttcgatggcactgcgttgtatgaatatgct
gatccgcgcgaagggtaccatcaggattggaataccctgatctataactatggccgtaac
gaagtccgtaactatctggcgggcaatgcattctactggatggaacgttttggcatcgat
gcgttgcgtattgatgcggtggcctcaatgatttaccgcgattatagccgtgctgaaggg
cagtgggtgcctaactattatggtggccgggaaaatttggaggctatcgctttcttgcgt
tacaccaataagaccattggcgttgaacgccccggcagtgtgaccatggcggaggagtca
accgactttcctggtgtgacattaccgcctgatattggtggcctgggtttcaactataaa
tggaacatgggttggatgcatgacacgctgaattatatgcaatgtgatcctgttcaccgc
aaataccaccataatttgatgacgttcggtatgttatacgcttataccgagaactttatc
ttaccgctctcccacgatgaagtggtccacggcaagcgctcgatacttgatcgtatgccg
ggtgatgcctggcagaaatttgccaacctacgggcttattacgcatttatgtgggcgcat
cccggtaaaaaactgctgtttatgggctgtgaatttgcgcaggggcgtgagtggaatttc
gaaaccagtctggattggcacctgctggacgatgaaaacggctggcattccggtgtgcag
cgtctggttcgtgaccttaaccattgctatcgccagtatgcgccgttgtatgaatgggat
tatcaacccgctggttttgaatggttggtggttgatgaccacgaaaattcggtattcgcc
ttcctgcgccgtgatgccgaggggcacgaactgattgctatcagtaatttcaccccggtt
ccacgttatcactaccgtgtgggcattccacaaggtggtcactaccgtgaagtgttgaat
tctgactctgcattttactgcggcagtaacctgggtaatcagggcggcattgatagccat
catgtgaggagccacaaccacgagcattcgttgttactcaccttgccaccgctggcaacg
atttacctgctgcgggagaactag

DBGET integrated database retrieval system