KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0080Help
Entry
YP_0080           CDS       T00165                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00030  Pentose phosphate pathway
ypm00051  Fructose and mannose metabolism
ypm00052  Galactose metabolism
ypm00680  Methane metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
ypm01230  Biosynthesis of amino acids
ypm03018  RNA degradation
Module
ypm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_0080 (pfkA)
   00030 Pentose phosphate pathway
    YP_0080 (pfkA)
   00051 Fructose and mannose metabolism
    YP_0080 (pfkA)
   00052 Galactose metabolism
    YP_0080 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    YP_0080 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YP_0080 (pfkA)
Enzymes [BR:ypm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YP_0080 (pfkA)
Protein phosphatases and associated proteins [BR:ypm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YP_0080 (pfkA)
Messenger RNA biogenesis [BR:ypm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YP_0080 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AAS60360
UniProt: Q8ZJL6
Position
88085..89068
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgatggttcttatgctggtgcggacctgctgacaaaagaagggggaattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgccggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgaaaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgtattcttgcttcccgtatgggggcttatgctgtcgatttgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtacagaatgagaagatggtgcatgag
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system