KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0089Help
Entry
YP_0089           CDS       T00165                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YP_0089 (tpiA)
   01230 Biosynthesis of amino acids
    YP_0089 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_0089 (tpiA)
   00051 Fructose and mannose metabolism
    YP_0089 (tpiA)
   00562 Inositol phosphate metabolism
    YP_0089 (tpiA)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YP_0089 (tpiA)
Exosome [BR:ypm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YP_0089 (tpiA)
  Exosomal proteins of bladder cancer cells
   YP_0089 (tpiA)
  Exosomal proteins of melanoma cells
   YP_0089 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(97925..98692)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system