KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0089Help
Entry
YP_0089           CDS       T00165                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00051  Fructose and mannose metabolism
ypm00562  Inositol phosphate metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
ypm01230  Biosynthesis of amino acids
Module
ypm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypm_M00002  Glycolysis, core module involving three-carbon compounds
ypm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_0089 (tpiA)
   00051 Fructose and mannose metabolism
    YP_0089 (tpiA)
   00562 Inositol phosphate metabolism
    YP_0089 (tpiA)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YP_0089 (tpiA)
Exosome [BR:ypm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YP_0089 (tpiA)
  Exosomal proteins of bladder cancer cells
   YP_0089 (tpiA)
  Exosomal proteins of melanoma cells
   YP_0089 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAS60368
UniProt: Q8ZJK9
Position
complement(97925..98692)
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAIYLNQAKHELAGSRIA
LGAQNVDVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHQESDELIAKKFGVLKEIG
LIPVLCIGESEAENEAGQTEAVCAKQLDAVLNTLGVKAFEGAVIAYEPIWAIGTGKSATP
AQAQAVHKFIRDHIAKQDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAKAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccattagttatgggtaactggaagctgaacggtagtactcatatggttaac
gagcttatcgctggcctgcgtaaagaattgagcaccgttgatggttgtggcgttgccatt
gccccaccggcgatctatctaaatcaggcaaaacatgagcttgctggtagccgtattgct
ctgggtgctcaaaacgtcgatgtgaacctctccggcgcatttaccggtgaaacatctgct
gaaatgctgaaagatatcggtgcgcaatacattattatcggccactctgagcgccgtact
tatcaccaagaaagtgatgaattgatcgcgaagaaatttggcgtactgaaagagatcggc
ttgatcccagtattgtgtatcggtgagtccgaagcagaaaacgaagcgggccaaactgaa
gcagtatgcgccaaacaactggacgccgtgctgaataccctaggcgtgaaagcgttcgaa
ggtgcggttatcgcttatgagccaatctgggctatcggtaccggtaaatcagcaactcca
gcgcaggctcaggctgttcacaaatttatccgtgaccatatcgccaagcaagacgcagca
gttgcagcacaagtgatcattcagtacggcggttctgttaacgataaaaacgcagcagaa
ttgttcactcagccagatattgatggcgcactggttggcggtgcatcactgaaagcagac
gctttcgcagttatcgtgaaagcagccgctaaagctaaaaaagcctaa

DBGET integrated database retrieval system