KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0206Help
Entry
YP_0206           CDS       T00165                                 

Gene name
rpsJ
Definition
30S ribosomal protein S10
Orthology
K02946  
small subunit ribosomal protein S10
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:ypm03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220367..220678
Genome map
AA seq 103 aa AA seqDB search
MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccaaagaatccgtatccgcctgaaagcgtttgatcatcgtttgatcgatcaa
tcaactgcggaaatcgtcgagactgccaagcgcactggtgcgcaggttcgtggtccgatc
ccgctgccaactcgcaaagagcgctttaccgttctgatttctccgcacgtcaataaagat
gcgcgcgatcagtacgaaattcgcactcacaagcgtctggttgacatcgttgagccaacc
gagaaaaccgttgatgctctgatgcgtctggatctggctgccggtgtagacgtgcagatc
agcctgggttaa

DBGET integrated database retrieval system